Information report for 462952009
Gene Details
Functional Annotation
- Refseq: XP_025802594.1 — two-component response regulator ORR24-like
- Swissprot: A2X1N2 — ORR24_ORYSI; Two-component response regulator ORR24
- TrEMBL: A0A1E5VNB3 — A0A1E5VNB3_9POAL; Two-component response regulator ORR24 (Fragment)
- TrEMBL: A0A3L6QJB6 — A0A3L6QJB6_PANMI; Two-component response regulator
- TrEMBL: A0A3L6RP70 — A0A3L6RP70_PANMI; Two-component response regulator
- STRING: Pavir.Ab00568.1.p — (Panicum virgatum)
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Homologs
- Hordeum vulgare: MLOC_3955.1
- Oryza sativa: LEPTO1;OsRR24
- Panicum virgatum: Pavir.1KG088000.1.p, Pavir.1KG089500.1.p, Pavir.1NG079300.1.p
- Setaria italica: Seita.1G061200.1.p
- Setaria viridis: Sevir.1G060800.1.p
Sequences
CDS Sequence:
- >462952009|Eragrostis_tef|ARR-B|462952009
ATGACCGTGGAGGAGGTGAAGCCGCTGGGGAAGGCGAACGGGCATGGCGGAAAGGACCAGTTCCCCGTCGGCATGCGCGTGCTCGCTGTTGACGATGACCCCACCTGCCTCAAGGTGCTCGAGAGCCTCTTGCAGCGCTGCCAGTATCACGTGACAACAACTGGACAGGCGGCCACAGCCCTGAAGCTGCTGAGGGAGAAGAAGGACCAGTTTGACCTGGTGATCAGTGATGTCCACATGCCGGACATGGATGGCTTCAAGCTCCTCGAGCTTGTGGGCCTCGAGATGGACCTCCCGGTCATCATGCTGTCAGCAAACGGGGAGACACAAACAGTCATGAAGGGTATCACCCATGGAGCATGTGACTACCTGCTTAAGCCAGTGCGTCTTGAGCAGTTGAGGACGATATGGCAACATGTGGTTAGGCGGAGGAGTTGTGATGCCAAGAACCATGGTAATGAGAATGAAGATGGGGGTAAGAAGGCACTGAATGCTGAAGGTGAGAATGGTGGTGCTAATCGCAACAAGAGGACTTCACGCAAGGGTAGGGATGAAGACGATGGTAATGATTCTGATGAGAATAGTAATGAGAATGGAGACTCATCGACACAAAAGAAGCCAAGGGTGGTGTGGTCGGTTGAATTGCACCGAAAGTTTGTGGCTGCGGTCAACCAGCTAGGCATTGACAAGGCTGTTCCGAAGAAAATATTGGATCTCATGAATGTTGAGAACATCACCAGGGAGAATGTTGCGAGTCATTTGCAGCGTCCTGGGAAGCTGGCAATGCCACAAGATCTTGAGATTTTAGCAAATGCTGCTGCTTGCAAACTGAAATGTTTTGCTATCTCCATAATAGCTTGCTACAGCTACACCAACTGA
Protein Sequence:
- >462952009|Eragrostis_tef|ARR-B|462952009
MTVEEVKPLGKANGHGGKDQFPVGMRVLAVDDDPTCLKVLESLLQRCQYHVTTTGQAATALKLLREKKDQFDLVISDVHMPDMDGFKLLELVGLEMDLPVIMLSANGETQTVMKGITHGACDYLLKPVRLEQLRTIWQHVVRRRSCDAKNHGNENEDGGKKALNAEGENGGANRNKRTSRKGRDEDDGNDSDENSNENGDSSTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVENITRENVASHLQRPGKLAMPQDLEILANAAACKLKCFAISIIACYSYTN