Gene Details:
- Gene ID: Ote100219760101
- Gene Family: ARF Family
- Description: ARF Family protein
- Species: Ocimum tenuiflorum
- Source: ARF family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:2.40.330.10
- SuperFamily: SSF101936
- Pfam: PF02362
- PROSITE profile: PS50863
- SMART: SM01019
- Pfam: PF06507
- PROSITE profile: PS51745
- SuperFamily: SSF54277
- Pfam: PF02309
- InterPro: IPR015300 IPR003340 IPR010525 IPR000270 IPR033389
Annotation Proteins:
- Refseq: XP_011089884.1 — auxin response factor 4 isoform X2
- Swissprot: Q9ZTX9 — ARFD_ARATH; Auxin response factor 4
- TrEMBL: A0A2G9H945 — A0A2G9H945_9LAMI; Auxin response factor
- STRING: Migut.N02611.1.p — (Erythranthe guttata)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009725 — Biological Process — response to hormone
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- Auxin response factors (ARF) are transcription factors that regulate the expression of auxin response genes. ARFs bind with specificity to TGTCTC auxin response elements (AuxRE) in promoters of these genes and function in combination with Aux/IAA (auxin/indole acetic acid) repressors, which dimerize with ARF activators in an auxin-regulated manner.
- Most ARFs consist of an amino-terminal DNA-binding domain (DBD), a middle region that functions as an activation domain (AD) or repression domain (RD), and a carboxy-terminal dimerization domain (CTD). The ARF DBD is classified as a plant-specific B3-type, but requires additional amino-terminal and carboxy-terminal amino acids for efficient in vitro binding to TGTCTC AuxREs.
- The ARF ADs and RDs are located just carboxy-terminal to the DBDs and contain biased amino acid sequences. ARF ADs are enriched in glutamine along with serine and leucine residues, while ARF RDs are enriched in serine, proline, leucine and glycine residues.
Literature:
- Auxin response factors. DOI: 10.1016/j.pbi.2007.08.014 ; PMID: 17900969
Sequences:
CDS Sequence:
- >Ote100219760101|Ocimum_tenuiflorum|ARF|Ote100219760101
Protein Sequence:
- >Ote100219760101|Ocimum_tenuiflorum|ARF|Ote100219760101
MEIDLNLALCDDMEKNACDNGGECYHFSLSGSAPCYSSNAAASXXXXXXXXXXXXXXXXXXXXXXXXXELWHACAGPVAILPKKGDLVVYFPQGHLEQAYSSTFSPKEMPQFDLPPQILCRVVDAQLIANKENDEVYAQLTLHPRPQMVGVELEGKEKEYVGVDEGGNGEAPAKSTSQMFCKTLTASDTSSHGGFSVPRRAAEDCFPPLNYEKQRPSQELVATDLHGVEWRFRHIYRGQPRRHLLTTGWSTFVSQKNLVSGDAVLFLRGEAGDLRLGIRRAARPRYSIPDSIINDQNHYPNVLSHVANAISSNGMFNVVYSPRTSHSNFIVPYQNYLKCNAKLIPIGTRFEMKYTMDDSPERRCSGVVTGVGDADPYRWPNSKWRSLVVRWDDVVDHQERVSPWEINSSSSYANPNTQPFPGVKRLRPNLLASPNGSSHSSGGGVVSDFGEYVRSLKVLQGQENMGFVLPLYRSDRAIPNIMEKISNGEFVRSQAPATFTGFLESNWFPKVLQGQEICSFQYLARKCGWNVYKTYQFPTPGFYPLASEGARNMSVFRASPTHSGVATDVGKVLHFADETCAPETELEKIPVCRLFGYSLNEDSAILNMQRQSKRRCSKVHRHGYKELLTELDRLFSMKGLVHDPNHVGSKANVLIMAIFNSRADACNNPNARLSAVFLGDARWGIHSHSHCHPDTESPET