Information report for cra_locus_10372_iso_1
Gene Details
|
|
Functional Annotation
- Refseq: XP_027085933.1 — auxin response factor 18-like
- Refseq: XP_027085940.1 — auxin response factor 18-like
- Refseq: XP_027085948.1 — auxin response factor 18-like
- Refseq: XP_027085957.1 — auxin response factor 18-like
- Refseq: XP_027085965.1 — auxin response factor 18-like
- Refseq: XP_027085973.1 — auxin response factor 18-like
- Refseq: XP_027085983.1 — auxin response factor 18-like
- Refseq: XP_027085989.1 — auxin response factor 18-like
- Refseq: XP_027085998.1 — auxin response factor 18-like
- Refseq: XP_027182473.1 — auxin response factor 18
- Refseq: XP_027182479.1 — auxin response factor 18
- Refseq: XP_027182486.1 — auxin response factor 18
- Refseq: XP_027182494.1 — auxin response factor 18
- Refseq: XP_027182500.1 — auxin response factor 18
- Refseq: XP_027182508.1 — auxin response factor 18
- Swissprot: Q653H7 — ARFR_ORYSJ; Auxin response factor 18
- TrEMBL: A0A068UFQ3 — A0A068UFQ3_COFCA; Auxin response factor
- STRING: XP_009602946.1 — (Nicotiana tomentosiformis)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0007389 — Biological Process — pattern specification process
- GO:0009734 — Biological Process — auxin-activated signaling pathway
- GO:0009738 — Biological Process — abscisic acid-activated signaling pathway
- GO:0009743 — Biological Process — response to carbohydrate
- GO:0010154 — Biological Process — fruit development
- GO:0031540 — Biological Process — regulation of anthocyanin biosynthetic process
- GO:0048366 — Biological Process — leaf development
- GO:0048441 — Biological Process — petal development
- GO:0048442 — Biological Process — sepal development
- GO:0048589 — Biological Process — developmental growth
- GO:0048829 — Biological Process — root cap development
- GO:0051301 — Biological Process — cell division
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0005515 — Molecular Function — protein binding
Family Introduction
- Auxin response factors (ARF) are transcription factors that regulate the expression of auxin response genes. ARFs bind with specificity to TGTCTC auxin response elements (AuxRE) in promoters of these genes and function in combination with Aux/IAA (auxin/indole acetic acid) repressors, which dimerize with ARF activators in an auxin-regulated manner.
- Most ARFs consist of an amino-terminal DNA-binding domain (DBD), a middle region that functions as an activation domain (AD) or repression domain (RD), and a carboxy-terminal dimerization domain (CTD). The ARF DBD is classified as a plant-specific B3-type, but requires additional amino-terminal and carboxy-terminal amino acids for efficient in vitro binding to TGTCTC AuxREs.
- The ARF ADs and RDs are located just carboxy-terminal to the DBDs and contain biased amino acid sequences. ARF ADs are enriched in glutamine along with serine and leucine residues, while ARF RDs are enriched in serine, proline, leucine and glycine residues.
Literature and News
- Auxin response factors. DOI: 10.1016/j.pbi.2007.08.014 ; PMID: 17900969
Gene Resources
Homologs
- Nicotiana attenuata: A4A49_34845
- Nicotiana tabacum: XP_016433571.1, XP_016433570.1, XP_016433569.1, XP_016433568.1, XP_016433567.1
- Petunia inflata: Peinf101Scf02234g00021.1
- Salvia miltiorrhiza: SMil_00000332-RA_Salv
- Sesamum indicum: XP_011089288.1, XP_011089287.1
- Vitis vinifera: VIT_06s0004g02750
Sequences
CDS Sequence:
- >cra_locus_10372_iso_1|Catharanthus_roseus|ARF|cra_locus_10372_iso_1
Protein Sequence:
- >cra_locus_10372_iso_1|Catharanthus_roseus|ARF|cra_locus_10372_iso_1
MVEKSLDSQLWHACAGGMVQMPSVNSKVFYFSQGHAEHTLSNVDFAGMPRIPAVILCRVSAVKFLADPETDEVFARIRLIPIGNNEGYEFEDDSCMGNTNGSESSADKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYTADPPVQTVVAKDVHGETWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGGIGGPESSSGWNSAAGNYGSFSVFLREEENKLMRSGGSNGNLNSSAGGGGNLKGRGRARPESVIEAASLAASGQPFEVVYYPRASTPEFFVKASSVSSAMRVQWCAGMRFKMPFETEDSSRISWFMGTIASVQVADPIRWPNSPWRLLQVTWDEPDLLQNVKRVNPWLVELVSNMPVIHLSPFSPPRKKLRIPQHSEFPLDGQFPMPSFSGNPFGPSSPLCCPSDNISAGIQGARHAQFGVPLLDLHLSNKMHLGLIPPSFQRLDPLTKIPDGLIHGHLEGGDDVSCLLTMGNSNQKLEKTDAVKNPDSCLFGQPILTEQQMSHSCSSDALSQAGKSSSCVISPPKAERFTLDQTENIPNTGFLRNRSRHSVDIGLDTGHCKVFLESEDVGRTLDLSVVGSYEELYKRLGNMFGIERSEMESNVFYRDATGALKQTGDEPFRYMFCLXQNTLIIYEMFHIPNGHLFPFAVTCSEFMKTAKRLTIHKNSGNNTIGRKWITGLPSGERGLDSSNQTGPLSIFA