Gene Details:

  • Gene ID: Ote100217740121
  • Gene Family: AP2 Family
  • Description: AP2 Family protein
  • Species: Ocimum tenuiflorum
  • Source: AP2 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_020552183.1  — floral homeotic protein APETALA 2-like isoform X1
  • Swissprot:  B8AXC3  — AP21_ORYSI; APETALA2-like protein 1
  • TrEMBL:  A0A4D9AJE7  — A0A4D9AJE7_SALSN; AP2-like factor, euAP2 lineage
  • STRING:  XP_009611308.1  — (Nicotiana tomentosiformis)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding. These three families have been defined as follows. The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, in addition to the single AP2/ERF domain.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development, spikelet meristem determinacy, leaf epidermal cell identity, and embryo development.
  • Using an in vitro selection procedure, the DNA binding specificity of the two AP2 repeat containing protein ANT was found to be 5’-gCAC(A/G)N(A/T)TcCC(a/g)ANG(c/t)-3’. This consensus site is much longer than sites recognized by proteins containing a single AP2 repeat and neither AP2 repeat of ANT was alone capable of binding to the selected sequences, suggesting that both AP2 repeats make DNA contacts.

Literature:

Sequences:

CDS Sequence:
  • >Ote100217740121|Ocimum_tenuiflorum|AP2|Ote100217740121
Protein Sequence:
  • >Ote100217740121|Ocimum_tenuiflorum|AP2|Ote100217740121
    MFDLNLTLDSNGDDHFDADGWSRESSSNDDAVLAFNSDISNSSDQAPIPSDSELVTRDLFPVTRPGELDRCSEIQYSSPQAAVQQELQQVQAVQARKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTALAAARAYDRAAIKFRGVEADINFNLNDYHDMKQMMNLSKEEFVQTLRRQSNGFSRGSCKYRSVRWDARSGEHLGMKLISWHIPRVYDKAGVMCKGNEPVTRFDPNTHDIGEATRHGTQHDLNLNLGMSASSQNENGRLEDSSKLNHVAQSSTTSKLHMGSNIIYDPPLEGVPTRFQHPYTAVNPNFAPNNEGMQGHDPTAQNTTAASSGFSSTPNTPTTYSWINPYLPSS