Information report for Ciclev10025985m
Gene Details
|
|
Functional Annotation
- Refseq: XP_006427681.1 — AP2-like ethylene-responsive transcription factor At1g16060 isoform X1
- Swissprot: Q94AN4 — AP2L1_ARATH; AP2-like ethylene-responsive transcription factor At1g16060
- TrEMBL: V4SUT2 — V4SUT2_9ROSI; Uncharacterized protein
- STRING: XP_006427681.1 — (Citrus clementina)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009651 — Biological Process — response to salt stress
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0010187 — Biological Process — negative regulation of seed germination
- GO:0040008 — Biological Process — regulation of growth
- GO:0045723 — Biological Process — positive regulation of fatty acid biosynthetic process
- GO:1901959 — Biological Process — positive regulation of cutin biosynthetic process
- GO:0005634 — Cellular Component — nucleus
- GO:0000981 — Molecular Function — RNA polymerase II transcription factor activity, sequence-specific DNA binding
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding. These three families have been defined as follows. The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, in addition to the single AP2/ERF domain.
- It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
- Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development, spikelet meristem determinacy, leaf epidermal cell identity, and embryo development.
- Using an in vitro selection procedure, the DNA binding specificity of the two AP2 repeat containing protein ANT was found to be 5’-gCAC(A/G)N(A/T)TcCC(a/g)ANG(c/t)-3’. This consensus site is much longer than sites recognized by proteins containing a single AP2 repeat and neither AP2 repeat of ANT was alone capable of binding to the selected sequences, suggesting that both AP2 repeats make DNA contacts.
Literature and News
Gene Resources
Homologs
- Citrus sinensis: orange1.1g018990m
- Gossypium arboreum: Cotton_A_17105_BGI-A2_v1.0
- Lactuca sativa: Lsa011388
- Malus domestica: MDP0000166059
- Manihot esculenta: Manes.13G048400.1.p, Manes.04G100700.1.p
- Nicotiana tabacum: XP_016457719.1, XP_016483746.1
- Petunia inflata: Peinf101Scf01633g11068.1
- Populus trichocarpa: Potri.003G185300.1
- Prunus mume: XP_008223596.1
- Prunus persica: Prupe.1G101600.1.p
- Solanum lycopersicum: Solyc03g117720.2.1
- Ziziphus jujuba: XP_015895815.1
Sequences
CDS Sequence:
- >Ciclev10025985m|Citrus_clementina|AP2|Ciclev10025985m
ATGGCGAAAACCTCAAGGCAAAGCCAAAAGAACACTACTACAAACCCTAATAACAATAATACAGTCACGACCAAGACTAAGAGAACAAGAAAAAGCGTGCCCCGTGACTCGCCGCCGCAACGTAGCTCGATCTACCGAGGCGTTACCAGGCATCGATGGACGGGACGATATGAAGCTCATTTGTGGGATAAAAATTGCTGGAATGAGTCTCAAAACAAGAAAGGGAGACAAGTATATTTAGGTGCTTATGATAATGAAGAAGCTGCAGCACGTGCCTATGATTTGGCAGCATTGAAATATTGGGGACATGATACTATTCTTAATTTCCCACTTTCGAATTATGAAGAAGAGCTCGTAGAAATGGAGGGTCAGTCAAAAGAGGAATATATTGGTTCTTTAAGGAGAAAAAGTAGTGGATTTTCTCGAGGGGTCTCCAAATATAGAGGCGTAGCAAGACACCATCACAATGGCAGATGGGAAGCTCGAATTGGCAGAGTTTTTGGCAACAAATATCTCTATCTTGGAACTTATGCTACTCAAGAAGAAGCAGCTCAAGCCTATGACAGGGCAGCAATAGAGTATCGTGGACTTAATGCTGTCACCAACTTTGATCTTAGCAAATACATTAAGTGGTTACGCCCAAATAATAATCAAAATAACCCTAAACCTAGCAACCCTCAACAAAACCCTAATAGTGATGACACAAGTCCAATTCCAAAACTAAATCAGGAAACCTCAAGCGGTAGTGACACGTCAGCACCTCCACCACGGTCTGGTGCTACCGCAGGAGGTAGCGGCTCGGCGTCATCGGCATTAGGGCTTTTGCTACAATCGTCAAAATATAAGGAAATGGTGGAGAAAACTTCAACAGATTGTTTATCTACGTCATCAGAACCTGGTTCTTCACACCGGATTTTTCCTGATGATATTCAGACGATGTTTTTCGATTGTCAGGACTCTAGCAGCTACACGGAGGGTGATGACGTTCTATTGGGTGACCTAAATCCATATATTTTCCCAACTTTTTATAGTGAACTTGATAATTAG
Protein Sequence:
- >Ciclev10025985m|Citrus_clementina|AP2|Ciclev10025985m
MAKTSRQSQKNTTTNPNNNNTVTTKTKRTRKSVPRDSPPQRSSIYRGVTRHRWTGRYEAHLWDKNCWNESQNKKGRQVYLGAYDNEEAAARAYDLAALKYWGHDTILNFPLSNYEEELVEMEGQSKEEYIGSLRRKSSGFSRGVSKYRGVARHHHNGRWEARIGRVFGNKYLYLGTYATQEEAAQAYDRAAIEYRGLNAVTNFDLSKYIKWLRPNNNQNNPKPSNPQQNPNSDDTSPIPKLNQETSSGSDTSAPPPRSGATAGGSGSASSALGLLLQSSKYKEMVEKTSTDCLSTSSEPGSSHRIFPDDIQTMFFDCQDSSSYTEGDDVLLGDLNPYIFPTFYSELDN*