Gene Details:
- Gene ID: Solyc05g010000
- Gene Symbol: SlIDA
- Gene Name: IDA homolog
- Genome: Tomato Genome version SL4.0
- Species: Solanum lycopersicum
Functional Descriptions:
- SlIDA expression during anther development and pollen tube elongation.
- Tomato SlIDA has a critical role in tomato fertilization by modifying reactive oxygen species homeostasis.
- We generated tomato knockout lines (CR-SlIDA) of an IDA homolog (SlIDA), which is expressed in the tapetum, septum and pollen tube, and observed a severe defect in male gametes.
- Liquid chromatography-tandem mass spectrometry identified mature SlIDA as a 14-mer EPIP peptide, which was shown to be secreted, and a complementation experiment showed that application of a synthetic 14-mer EPIP peptide rescued the CR-SlIDA defect and enhanced the ROS signal.
- Collectively, our results revealed that SlIDA plays an essential role in pollen development and pollen tube elongation by modulating ROS homeostasis.
Function-related keywords:
- development , pollen , anther , tapetum , pollen-development , homeostasis , anther-development , pollen-tube-elongation , reactive-oxygen-species
Literature:
- Tomato SlIDA has a critical role in tomato fertilization by modifying reactive oxygen species homeostasis. DOI: 10.1111/tpj.14886 ; PMID: 32573872
Related News:
Gene Resources:
- NCBI ID:
- UniProt accessions: A0A3Q7GEW5
Orthologs:
Sequences:
cDNA Sequence
- >Solyc05g010000.1.1
ATGGCTTTCTCTTTTTCTTCTTCAAAAACCCTTTATTTATCAAGCAAATTAACTTGTTTGATACTTGTTATTTCTCTACTTTTTAATTATGGTCATATTGTTGAAGCATCAAGATTTGGGAGAATTATGATGGTAGAGGAAAATTCAAGAATATTTTCATCACAACATATGAAGGTATACAAAAAAGAAAATGCATACAAAGTTGATAATTTATTATTTACTATGTTACCAAAAGGGATTCCAATTCCTCCTTCTGCTCCATCAAAGAGACATAATGCTATTGAAGACTCTACACCTCAAAATTGA
CDS Sequence
- >Solyc05g010000.1.1
ATGGCTTTCTCTTTTTCTTCTTCAAAAACCCTTTATTTATCAAGCAAATTAACTTGTTTGATACTTGTTATTTCTCTACTTTTTAATTATGGTCATATTGTTGAAGCATCAAGATTTGGGAGAATTATGATGGTAGAGGAAAATTCAAGAATATTTTCATCACAACATATGAAGGTATACAAAAAAGAAAATGCATACAAAGTTGATAATTTATTATTTACTATGTTACCAAAAGGGATTCCAATTCCTCCTTCTGCTCCATCAAAGAGACATAATGCTATTGAAGACTCTACACCTCAAAATTGA
Protein Sequence
- >Solyc05g010000.1.1
MAFSFSSSKTLYLSSKLTCLILVISLLFNYGHIVEASRFGRIMMVEENSRIFSSQHMKVYKKENAYKVDNLLFTMLPKGIPIPPSAPSKRHNAIEDSTPQN*