Gene Details:
- Gene ID: Solyc02g077840
- Gene Symbol: SlERF.F12
- Gene Name: AP2/ERF domain-containing protein
- Genome: Tomato Genome version SL4.0
- Species: Solanum lycopersicum
Functional Descriptions:
- SlERF.F12 modulates the transition to ripening in tomato fruit by recruiting the co-repressor TOPLESS and histone deacetylases to repress key ripening genes.
- SlERF.F12, a member of the ERF.F subfamily containing Ethylene-responsive element-binding factor-associated Amphiphilic Repression (EAR) motifs, negatively regulates the onset of tomato (Solanum lycopersicum) fruit ripening by recruiting the co-repressor TOPLESS 2 (TPL2) and the histone deacetylases (HDAs) HDA1/HDA3 to repress the transcription of ripening-related genes.
- SlERF.F12 interacts with the co-repressor TPL2 via the C-terminal EAR motif and recruits HDAs SlHDA1 and SlHDA3 to form a tripartite complex in vivo that actively represses transcription of ripening genes by decreasing the level of the permissive histone acetylation marks H3K9Ac and H3K27Ac at their promoter regions.
- We demonstrate that SlERF.F12 negatively regulates the onset of tomato fruit ripening by recruiting the co-repressor TOPLESS protein 2 (TPL2) and the histone deacetylases (HDAs) HDA1/HDA3 to repress the transcription of ripening-related genes.
Function-related keywords:
Literature:
- SlERF.F12 modulates the transition to ripening in tomato fruit by recruiting the co-repressor TOPLESS and histone deacetylases to repress key ripening genes. DOI: 10.1093/plcell/koac025 ; PMID: 35099538
Related News:
Gene Resources:
- NCBI ID: 101259210
- UniProt accessions: A0A3Q7F492
Sequences:
cDNA Sequence
- >Solyc02g077840.2.1
ATGGCTTCCACTCGTGAGGGTCACTACAGAGGAGTGAGAAAGCGTCCCTGGGGCCGTTACGCCGCAGAGATTCGCGACCCGTGGAAGAAAACACGTGTCTGGTTAGGCACTTTCGACACTCCAGAAGAAGCGGCACTCGCTTACGACGGCGCCGCCCGTTCACTCCGCGGCGCTAAAGCAAAAACAAACTTCCCCCTCCTCCGCCGCCGCCGCCGCAGCCTTCTTCCGCTCCTCTTACACTCGATCTCAACCTTCCATCTGATCACCGGTGGACTTCCCCCTCCGGACGTAGGCTCATGATTGGAGAGTTTCTACAAGTAGGTCCGCCGCCGGAACTTAACTTGCCGGTCACCGTCGCTGCGCCGGCGAAGGAAAACGATGTTGGAGCTGCAGCTATGTATTTTGGGATTGTGAGACGTGGGTTGCCTATTGACTTGAACGAACCGCCGCCGTTGTGGATGTGA
CDS Sequence
- >Solyc02g077840.2.1
ATGGCTTCCACTCGTGAGGGTCACTACAGAGGAGTGAGAAAGCGTCCCTGGGGCCGTTACGCCGCAGAGATTCGCGACCCGTGGAAGAAAACACGTGTCTGGTTAGGCACTTTCGACACTCCAGAAGAAGCGGCACTCGCTTACGACGGCGCCGCCCGTTCACTCCGCGGCGCTAAAGCAAAAACAAACTTCCCCCTCCTCCGCCGCCGCCGCCGCAGCCTTCTTCCGCTCCTCTTACACTCGATCTCAACCTTCCATCTGATCACCGGTGGACTTCCCCCTCCGGACGTAGGCTCATGA
Protein Sequence
- >Solyc02g077840.2.1
MASTREGHYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPLLRRRRRSLLPLLLHSISTFHLITGGLPPPDVGS*