Gene Details:

Functional Descriptions:

  • The SlTPL3–SlWUS module regulates SAM size by mediating auxin distribution and GA levels, and perturbations of this module result in enlarged SAM. These results provide novel insights into the molecular mechanism of SAM maintenance and locule formation in tomato and highlight the SlTPL3–SlWUS module as a key regulator.
  • Recent studies have demonstrated that a mutation in CLAVATA3 (SlCLV3), caused by a 294-kb inversion with breakpoints in intron 1 of YABBY and 1 kb upstream of SlCLV3, in fact underlies the fas mutant phenotype.
  • SlCLV3, in fact underlies the fas mutant phenotype.
  • A SlCLV3-SlWUS module regulates auxin and ethylene homeostasis in low light-induced tomato flower abscission.

Literature:

Gene Resources:

Sequences:

cDNA Sequence
  • >Solyc11g071380.1.1
    ATGTCTTTGATCAATGCTAAATATTTCAATCTCTTTGTCTTGCTGATCTGTTTTTTAGTAATTCAAGAATCTCATGGTCTGTCTCTAAAGGAAGTTGCTCCTGTGAAACTCCTAAACAGAAAGGTTTTAGAAAGGCAGTGGGCTGCATTTGGGAAGGTATACTACAAGCATGCAGAGAAGATTAATGAGAAGTTTGCTGATTGGGAGCTAAGAGGAGTTCCAGCTGGTCCTGATCCATTGCATCACAATGGTGCTAGTCCTAAGAAACCTAAGACTCCATAA
CDS Sequence
  • >Solyc11g071380.1.1
    ATGTCTTTGATCAATGCTAAATATTTCAATCTCTTTGTCTTGCTGATCTGTTTTTTAGTAATTCAAGAATCTCATGGTCTGTCTCTAAAGGAAGTTGCTCCTGTGAAACTCCTAAACAGAAAGGTTTTAGAAAGGCAGTGGGCTGCATTTGGGAAGGTATACTACAAGCATGCAGAGAAGATTAATGAGAAGTTTGCTGATTGGGAGCTAAGAGGAGTTCCAGCTGGTCCTGATCCATTGCATCACAATGGTGCTAGTCCTAAGAAACCTAAGACTCCATAA
Protein Sequence
  • >Solyc11g071380.1.1
    MSLINAKYFNLFVLLICFLVIQESHGLSLKEVAPVKLLNRKVLERQWAAFGKVYYKHAEKINEKFADWELRGVPAGPDPLHHNGASPKKPKTP*