Gene Details:

Domain Features:

  • Domain Class:   L
  • Domain types:   LRR   

Domain Class Descriptions:

  • Contains a central nucleotide-binding (NB) subdomain as part of a larger entity called the NB-ARC domain. C-terminal to the NB-ARC domain lies a leucine-rich repeat (LRR) domain, which is sometimes followed by an extension of variable length. Hence, this group of R proteins is collectively referred to as NB-LRR proteins. If N-terminal region contain a predicted coiled-coil structures (CC), non-TIR NB-LRR proteins are collectively referred to as CC-NB-LRR or CNL.

Sequences:

Protein Sequence
  • >Traes_4BL_C4D2E294F
    PSLTRIRLGENYLNGTIPAKLFTLQNLTQVELHNNLLSGEVRLDADEVSPSIGELSLYNNGLSGPVPAG