Gene Details:
- Gene Name: Soltu.DM.08G021060
- Description: resistance gene
- Species: Solanum tuberosum
- Source: Resistance gene fromPRGdb 4.0
Domain Features:
- Domain Class: RLK
- Domain types: LRR LRR Kinase TM TM
Domain Class Descriptions:
- RLKs, or Receptor like Kinases, consist of an extracellullar leucine-rich repeat region (eLRR) that consist of 25-38aa conferring broad interaction surface that is well suited to interact with multiple ligands and an intracellular kinase domain. The eLRR domain plays the recognising role while the kinase triggers the downstream activation cascades. In Arabidopsis genome RLKs constitute a large gene family divided in 44 subclasses, 12 of them have the extracellular domain LRR while the other use different type of receptor like B-lactin and many others.
Sequences:
Protein Sequence
- >Soltu.DM.08G021060
MNNLTGQIPQSLGFLTRLQFLHLSENRLFGNVPLSIFSVSSLKDIDLSRNYELTGSLPNEICTNLPVLEYISLQDNQFVGELPSGLNICTKLEVLSLSYNKFTGNLPRDMWNMSKVQELFIGWNNFIGLYLGINNFSGTLPSSISNATKLKFLDLGRNMFSGNVPIDLGINLQQIQSINFQRNMLTNAPSSTGEISFLNSFSHCKGEIPVEIGNWTNLSWLTLGANEFIGSIPQELGNLKKLQTLRLYENKLDGIIPERLCDIKELYYFDLRRNQITGQLIGPLASEIGNMGGLSELYLSRNELFGPIPSTILQLQKLVFLALDMNRLDGTIPKSFEKMVSLEYLDLSQNNLTDQIPESLTKLEHLNYLNVSYNELSGEIPDGGPFGNFTAESFIGNEELCGPPRFQVKVCEVQNNVTRRNRKKTVLKFVLGPVADGGHALVVVHCDLKPSNIHLDGDMVARVSDFGISKLLTAYDPVALTKTLGTIGYMAPEGIVSTMGDVYCYGILLMETFTRKKPVDDEFVGDLTLKRWVAESYPHI