Gene Details:

  • Gene Name: Eucgr.G01279
  • Description: resistance gene
  • Species: Eucalyptus grandis
  • Source: Resistance gene fromPRGdb 4.0

Domain Features:

  • Domain Class:   T
  • Domain types:   TIR   

Domain Class Descriptions:

  • Contains a central nucleotide-binding (NB) subdomain as part of a larger entity called the NB-ARC domain. C-terminal to the NB-ARC domain lies a leucine-rich repeat (LRR) domain, which is sometimes followed by an extension of variable length. Hence, this group of R proteins is collectively referred to as NB-LRR proteins. If N-terminal region shows homology to the protein domain Interleukin-1 Receptor (IL-1R), called the TIR domain, these proteins are referred to as TIR-NB-LRR or TNL.

Sequences:

Protein Sequence
  • >Eucgr.G01279
    MLHTMSHLKSTLERREMKTFVDFTLDGGVPFRPAINEAVEWSKSAVVVVSQNYHLSPWCLNELVKILECQKRWGLVVLPIFWEMSARDLREQGGRFRGEYWPRRKGFQAG