Gene Details:

  • Gene ID: T459_03754
  • Suggest Gene Name: ASYMMETRIC LEAVES 1
  • Description: putative flowering gene
  • Species: Capsicum annuum
  • Source: Putative flowering gene from PlantCFG

Protein Features:

Functional Descriptions:

  • Encodes a MYB-domain protein involved in specification of the leaf proximodistal axis. Mutation results in lobed and dissected leaves with a characteristic asymmetry. Homologous to the Antirrhinum PHANTASTICA (PHAN) and maize ROUGH SHEATH2 (RS2) genes Asymmetric placement of auxin response at the distal leaf tip precedes visible asymmetric leaf growth. Acts alongside AXR1 to exclude BP expression in leaves and with PIN1 to repress BP and promote lateral organ growth. Interacts physically with AS2 to form a complex that binds to the BP promoter and silences BP. Also functions as a regulator of the plant immune response.

Homologous

Sequences:

CDS Sequence
  • >T459_03754
    ATGTCAGCCATCTCAAAGAAACTCCTGATTAAGAAGGGATCTTTAACCCCAAATGAACACAATCTTGTTATCTCTCTTCAGGCAAAGTATGGTAACATGTGGAAGAAGATTGCTGCTCAAGTACCTGGATGTACTGCTAAAAGACTAGGTAAGTGGTGGGAAGTTTTCAAGGAGAAACAACTTAAGCAAAGTCAAGATTACGTTGAGTCACCAGAGATTTTCGTCGTTTTTGGTGGTGGTGGGTCACCGAAAGGAGTAGTTTCCGATAAGTACGATCATATACTAGAGATTTTTGCTGAGAAATACTGGGTTTTCTAA
Protein Sequence
  • >T459_03754
    MSAISKKLLIKKGSLTPNEHNLVISLQAKYGNMWKKIAAQVPGCTAKRLGKWWEVFKEKQLKQSQDYVESPEIFVVFGGGGSPKGVVSDKYDHILEIFAEKYWVF