Gene Details:

  • Gene ID: T459_02128
  • Suggest Gene Name: PHYTOCHROME B
  • Description: putative flowering gene
  • Species: Capsicum annuum
  • Source: Putative flowering gene from PlantCFG

Protein Features:

Functional Descriptions:

  • Red/far-red photoreceptor involved in the regulation of de-etiolation. Exists in two inter-convertible forms: Pr and Pfr (active). Involved in the light-promotion of seed germination and in the shade avoidance response. Promotes seedling etiolation in both the presence and absence of phytochrome A. Overexpression results in etiolation under far-red light. Accumulates in the nucleus after exposure to far red light. The phosphorylation state of the Ser-86 residue of the phytochrome B molecule alters dark reversion of the molecule.;Encodes photoreceptor phytochrome B

Homologous

Sequences:

CDS Sequence
  • >T459_02128
    ATGCAAGTTTCTTGGGGACACAAACACAGTGCACTGACCCTTGAGATAGAAGACTTTTTTCTTGGGAGTGTAATAGATGCTGTTGTTAGCCAAGTGATGTTATTGCTGAGGGAAAAGGGTGTGCAATTAATCCGGGATATACCAGAGGAAATTAAGACATTAATAGTTCATGGTGATCAAGTGAGAATTCAACAGGTCTTGGCAGATTTCTTGCTGAACATGGTACAGTATGCACCATCACCTGACGGGTGGGTAGAGATCCAACTTCGACCAAGTATAAAGCCATTATCTGATGGAGTAACTATTGTGCATATTGAACTCAGGATTGTATGCCCTGGTGAAGGGCTTCCTCCTGAATTGGTTCAAGACATGTTCCATAGCAGTCGGTGGGTAACTCAGGAAGGCCTAGGGCTGAGCATGTGCAGAAAAATGTTAAAGCTTATGAATGGAGAAATCCAGTATATCAGAGAATCAGAAAGATGCTATTTCCTGATTATCCTAGACCTGCCAATGACGACCCACAGGGGTTCAAAGAGTGTTAGCTAG
Protein Sequence
  • >T459_02128
    MQVSWGHKHSALTLEIEDFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLIVHGDQVRIQQVLADFLLNMVQYAPSPDGWVEIQLRPSIKPLSDGVTIVHIELRIVCPGEGLPPELVQDMFHSSRWVTQEGLGLSMCRKMLKLMNGEIQYIRESERCYFLIILDLPMTTHRGSKSVS