Gene Details:

  • Gene ID: T459_01312
  • Suggest Gene Name: SUPPRESSOR OF OVEREXPRESSION OF CO 1 , AGAMOUS-LIKE 20;Time of flowering 18
  • Description: putative flowering gene
  • Species: Capsicum annuum
  • Source: Putative flowering gene from PlantCFG

Protein Features:

Functional Descriptions:

  • Controls flowering and is required for CO to promote flowering. It acts downstream of FT. Overexpression of (SOC1) AGL20 suppresses not only the late flowering of plants that have functional FRI and FLC alleles but also the delayed phase transitions during the vegetative stages of development. AGL20/SOC1 acts with AGL24 to promote flowering and inflorescence meristem identity.AGL20 upregulates expression of AGL24 in response to GA.;Suppressor of Overexpression of Constans 1

Homologous

Sequences:

CDS Sequence
  • >T459_01312
    ATGGTGAGAGGGAAAACACAGATGAGGCGTATAGAGAACGCCACGAGCAGGCAAGTCACTTTCTCTAAGCGTAGAAATGGGCTGCTCAAAAAAGCTTTTGAGCTTTCAGTTCTGTGTGATGCTGAAGTTGGATTGATTATTTTTTCTCCAAGAGGAAAGCTCTATGAATTTGCCAGCTCTAGGTAA
Protein Sequence
  • >T459_01312
    MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRGKLYEFASSR