Gene Details:

  • Gene ID: Solyc12g077465.1
  • Suggest Gene Name: SUPPRESSOR OF FRIGIDA4
  • Description: putative flowering gene
  • Species: Solanum lycopersicum
  • Source: Putative flowering gene from PlantCFG

Protein Features:

Functional Descriptions:

  • Encodes SUF4 (SUPPRESSOR of FRI 4), a putative zinc-finger-containing transcription factor that is required for delayed flowering in winter-annual Arabidopsis. suf4 mutations strongly suppress the late-flowering phenotype of FRI (FRIGIDA) mutants. suf4 mutants also show reduced H3K4 trimethylation at FLC (FLOWERING LOCUS C), a floral inhibitor. SUF4 may act to specifically recruit a putative histone H3 methyltransferase EFS (EARLY FLOWERING IN SHORT DAYS) and the PAF1-like complex to the FLC locus.

Homologous

Sequences:

CDS Sequence
  • >Solyc12g077465.1
    ATGGGGAAGAGGAAGAAGAGATCATCCGATAAAGTATGGTGCTACTACCGTGACAGGGAGTTCGACGATGAGAAGATTTTGGTTCACCATCAAAAGGCTGAACACTTCAAATGCTGTGTTTGCCATAAGAAGCATTCTACTGCTGGCGGCATAGCCATTCACGTTCTCCAGGTTCACAAAGAAACCGTCAGCCAGTAA
Protein Sequence
  • >Solyc12g077465.1
    MGKRKKRSSDKVWCYYRDREFDDEKILVHHQKAEHFKCCVCHKKHSTAGGIAIHVLQVHKETVSQ