Gene Details:
- Gene ID: Solyc05g055660.2
- Suggest Gene Name: FLOWERING LOCUS T;FLOWERING LOCUS T 3a;Heading date 3a
- Description: putative flowering gene
- Species: Solanum lycopersicum
- Source: Putative flowering gene from PlantCFG
Protein Features:
- Pfam: PF01161
Functional Descriptions:
- FT, together with LFY, promotes flowering and is antagonistic with its homologous gene, TERMINAL FLOWER1 (TFL1). FT is expressed in leaves and is induced by long day treatment. Either the FT mRNA or protein is translocated to the shoot apex where it induces its own expression. Recent data suggests that FT protein acts as a long-range signal. FT is a target of CO and acts upstream of SOC1.;Flowering locus T gene 3a, Flowering locus T-like gene 1;Encodes a florigen that is an orthologue of Arabidopsis FT
Homologous
- Arabidopsis thaliana — AT1G65480
- Glycine max — Glyma.16G044200
- Oryza sativa — LOC_Os06g06320
Sequences:
CDS Sequence
- >Solyc05g055660.2
ATGCAACCTAAGGTTTATATCGGAGGGGACGATCTTCGCACCTTTTACACTCTGATTATGGTGGATCCTGATGCTCCAAGCCCAAGCAATCCTAACTTGAGGGAGTATCTACACTGGCTGGTCACAGATATCCCAGCAACTACAGATACAAGATTTGGAAATGAAATAGTATGCTACGAGAATCCAACGCCAACGATGGGAATTCATCGATTCGTTTTGTGTATCCCCCAGGATGGCGTCAAAATTTCTAACACAAGAGACTTTGCTGAGCTTTATAATCTTGGATTGCCTGTTGCATCTGTTTACTACAATTGCCATAGAGAGAGTGGTACTGGAGGACGTCGCGCA
Protein Sequence
- >Solyc05g055660.2
MQPKVYIGGDDLRTFYTLIMVDPDAPSPSNPNLREYLHWLVTDIPATTDTRFGNEIVCYENPTPTMGIHRFVLCIPQDGVKISNTRDFAELYNLGLPVASVYYNCHRESGTGGRRA