Gene Details:
- Gene ID: Solyc03g117425.1
- Suggest Gene Name: TOPLESS
- Description: putative flowering gene
- Species: Solanum lycopersicum
- Source: Putative flowering gene from PlantCFG
Protein Features:
- Pfam: PF00400
Functional Descriptions:
- Encodes a protein with several WD40 repeats at the C-terminus and predicted protein-protein interaction domains at the N-terminus. Together with the TOPLESS-RELATED PROTEINS (TPRs), it is thought to be involved in transcriptional repression of root-promoting genes in the top half of the embryo during the transition stage of embryogenesis. It can also interact with IAA12 through the EAR domain of IAA12 and the CTLH domain of TPL. The ability of IAA12 to repress transcription is diminished in a tpl-1 mutant background.
Homologous
- Arabidopsis thaliana — AT1G15750
Sequences:
CDS Sequence
- >Solyc03g117425.1
ATGGATGCAGAGAGTGACCAGGTGGCCTCTTTTGTTGCCATCAGTGGAATGTTGTGTAAATTTAACTCCCAAAGGTGTATGTCTAGCCTTACTCCAAAGCAATTCAAATATCCAAACCAATTTGCATTAGGTATTCCAGATGGTAGTGTTCATGTTTTTGAACCACTTGAATCTGGAGGTAAATGGGGTGTCCCTCCACCACTTGAAAATGGCTTTGCAAAAGGTGTGCCTTAG
Protein Sequence
- >Solyc03g117425.1
MDAESDQVASFVAISGMLCKFNSQRCMSSLTPKQFKYPNQFALGIPDGSVHVFEPLESGGKWGVPPPLENGFAKGVP