Gene Details:
- Gene ID: Solyc02g091500.1
- Suggest Gene Name: CALMODULIN-LIKE 24, TOUCH 2
- Description: putative flowering gene
- Species: Solanum lycopersicum
- Source: Putative flowering gene from PlantCFG
Protein Features:
- Pfam: PF13499
Functional Descriptions:
- Encodes a protein with 40% similarity to calmodulin. Binds Ca(2+) and, as a consequence, undergoes conformational changes. CML24 expression occurs in all major organs, and transcript levels are increased from 2- to 15-fold in plants subjected to touch, darkness, heat, cold, hydrogen peroxide, abscisic acid (ABA), and indole-3-acetic acid. However, CML24 protein accumulation changes were not detectable. The putative CML24 regulatory region confers reporter expression at sites of predicted mechanical stress; in regions undergoing growth; in vascular tissues and various floral organs; and in stomata, trichomes, and hydathodes. CML24-underexpressing transgenics are resistant to ABA inhibition of germination and seedling growth, are defective in long-day induction of flowering, and have enhanced tolerance to CoCl(2), molybdic acid, ZnSO(4), and MgCl(2). Also regulates nitric oxide levels.
Homologous
- Arabidopsis thaliana — AT5G37770
Sequences:
CDS Sequence
- >Solyc02g091500.1
ATGGCCAAAACTCCCAGCGACTCCAAACAGCCGGCAGTTTCATCGGCGGAGATGGACGGAGTCGAGAAGGTATTCAGGAAGTTTGACGCCAATGGCGACGGAAAAATCTCTCTATCGGAGCTTGGCGCGATTCTGAATGCACTTGGCAGTAAGACGTCGCCGGATGAGGTAAATAGAATAATGTTGGAAGTTGATACTGATGGGGATGGTTTTATTGACTTGAAAGAGTTTGCTGCTTTTTACTGTCCGCGAGGAGCGGACGGTGATAATAAGGAGCTTCGGGAGGCTTTCGACTTGTATGATAAGGACAAAAACGGCAAAATCACAGCGGCTGAATTGCATTCTGTTATGAAGAGCCTCGGAGAGAAGTGCTCGCTCAAGGATTGCCGTCGTATGATCAGCAAGGTGGATGTTGACGGCGATGGATGCGTTAACTTTGAGGAGTTTAAGAAGATGATGAGTAGGACGTGA
Protein Sequence
- >Solyc02g091500.1
MAKTPSDSKQPAVSSAEMDGVEKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVNRIMLEVDTDGDGFIDLKEFAAFYCPRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLGEKCSLKDCRRMISKVDVDGDGCVNFEEFKKMMSRT