Gene Details:
- Gene ID: Solyc01g102640.2
- Suggest Gene Name: NUP98A, DRACULA2,
- Description: putative flowering gene
- Species: Solanum lycopersicum
- Source: Putative flowering gene from PlantCFG
Protein Features:
- Pfam: PF04096
Functional Descriptions:
- DRA2 is a homolog of mammalian nucleoporin 98 and a likely component of the nuclear pore complex in Arabidopsis. It positively participates in the control of the hypocotyl elongation response to plant proximity and control of shade induced gene expression. Nucleoportin which redundantly inhibits flowering together with Nup98b through multiple pathways including clock, photoperiod, and age pathways. Gates flowering in a CONSTANS (CO)-independent mode and bypasses the CO checkpoint in photoperiodic signaling and integrated signals from multiple pathways to directly target FLOWERING LOCUS T (FT) for flowering control.
Homologous
- Arabidopsis thaliana — AT1G10390
Sequences:
CDS Sequence
- >Solyc01g102640.2
ATGGATGAGAGCAAGAAACCTCCAGTTGGACAAGGCCTCAACAAGACAGCTGAGATAACTCTTCTTAATGTCAGATGCATGAACAATTCGAATGAGAAGGAGTACATAGATGGACCAATGGTCAACAAGTACAGAGACCATAAGCCTTTAATGAAGCAATGA
Protein Sequence
- >Solyc01g102640.2
MDESKKPPVGQGLNKTAEITLLNVRCMNNSNEKEYIDGPMVNKYRDHKPLMKQ