Gene Details:

  • Gene ID: PGSC0003DMG400030007
  • Suggest Gene Name: ALTERED EXPRESSION OF APX2 8
  • Description: putative flowering gene
  • Species: Solanum tuberosum
  • Source: Putative flowering gene from PlantCFG

Protein Features:

Functional Descriptions:

  • Encodes a bifunctional protein that has 3’(2’),5’-bisphosphate nucleotidase and inositol polyphosphate 1-phosphatase activities and rescues sulfur assimilation mutants in yeast. It is involved in the response to cold, drought (negative regulator of drought tolerance), and ABA. Mutants in this gene exhibit enhanced induction of stress genes in response to cold, ABA, salt and dehydration due to higher accumulation of the second messenger, inositol (1,4,5)- triphosphate (IP(3)). Involved in degradation of small mRNAs. Mutants also affect the accumulation of miRNA target cleavage products. Regulates light-dependent repression of hypocotyl elongation and flowering time via its 3’(2’),5’-bisphosphate nucleotidase activity.

Homologous

Sequences:

CDS Sequence
  • >PGSC0003DMG400030007
    ATGTCCATTTTCGCCGGTCACTTCTTCATTAGAGACGGCAACTGCTGCTATTTGTTGTTGTCATCTGTCTTCGTCGAAGACATAGTGGATGAGGGAGATGAGAGAGGGGGCTGGGGTTTCGCGACTGGTGGTTCGCTGGTATCCTTGGCTAGGCTTGCTTTGCCTGAGCTCACAGGTCGAAGCACCGGAGCGGCGGTGCTCACAGTTTCACTCTTAGAATCAGAACACTGCTCAGGTGCTCACGATTTCTCATTCTTTGCTACTGTTTTTTCATCTGCTTTGAAAGTCCAAAAAACACTGTTGCAAGCAGATGTTCAATCAAAGTCTGACAAATCTCCTGTGACGGTGGCTGATTATGGCTCACAGGGCGTGGTTACCGTTGTTTTGCAGAAAGAGTTGGGTTCTGCTTCATTTTCATTAGTGGCTAAGGAGGTAATGTTTGAACTCTTAGCTGTTTAG
Protein Sequence
  • >PGSC0003DMG400030007
    MSIFAGHFFIRDGNCCYLLLSSVFVEDIVDEGDERGGWGFATGGSLVSLARLALPELTGRSTGAAVLTVSLLESEHCSGAHDFSFFATVFSSALKVQKTLLQADVQSKSDKSPVTVADYGSQGVVTVVLQKELGSASFSLVAKEVMFELLAV