Gene Details:

  • Gene ID: BGIOSGA006097
  • Suggest Gene Name: FLOWERING LOCUS T
  • Description: putative flowering gene
  • Species: Oryza indica
  • Source: Putative flowering gene from PlantCFG

Protein Features:

Functional Descriptions:

  • FT, together with LFY, promotes flowering and is antagonistic with its homologous gene, TERMINAL FLOWER1 (TFL1). FT is expressed in leaves and is induced by long day treatment. Either the FT mRNA or protein is translocated to the shoot apex where it induces its own expression. Recent data suggests that FT protein acts as a long-range signal. FT is a target of CO and acts upstream of SOC1.

Homologous

Sequences:

CDS Sequence
  • >BGIOSGA006097
    ATGTCAAGGGATCCACTTGTTGTAGGCAATGTGGTTGGGGATATCTTGGACCCATTTATCAAATCAGCATCACTCAGAGTGCTTTACAGCAATAGGGAACTGACTAATGGATCTGAGCTCAAGCCTTCACAAGTAGCGAACGAGCCAAGGATTGAGATTGCTGGTCGTGACATGAGGACACTTTACACTTTGAAATGGGCATTTATTTCACTGAGGAAATGA
Protein Sequence
  • >BGIOSGA006097
    MSRDPLVVGNVVGDILDPFIKSASLRVLYSNRELTNGSELKPSQVANEPRIEIAGRDMRTLYTLKWAFISLRK