Gene Details:

  • Gene ID: A4A49_65309
  • Suggest Gene Name: EARLY FLOWERING 4
  • Description: putative flowering gene
  • Species: Nicotiana attenuata
  • Source: Putative flowering gene from PlantCFG

Protein Features:

Functional Descriptions:

  • Encodes a novel nuclear 111 amino-acid phytochrome-regulated component of a negative feedback loop involving the circadian clock central oscillator components CCA1 and LHY. ELF4 is necessary for light-induced expression of both CCA1 and LHY, and conversely, CCA1 and LHY act negatively on light-induced ELF4 expression. ELF4 promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles. It is involved in the phyB-mediated constant red light induced seedling de-etiolation process and may function to coregulate the expression of a subset of phyB-regulated genes.

Homologous

Sequences:

CDS Sequence
  • >A4A49_65309
    CTTAATCGCCGCCGTCAAACATTAGCCAAATCCAACTCCCGCAAGACTAATAATCACATTATGGAGGAAGGTAATGACTCTGAGATGTGGAACTCTTTTTCCAACAATTATAGACAAGTTCAGTCGGTGTTGGATCGAAACGAATTGTTGATTCAACAAGTTAACGAGAACCATCGGTCGAGATCGCATGACAGTATGGTGCAGAACGTGGGCCTAATTCAGGAGCTGAACGGTAACATATCTAAAGTTGCTTCCCTCTATTCTGATTTCAATACCGACTTCACAACAATGGTTCATCAAAGAAAGAATGGCGTTTGA
Protein Sequence
  • >A4A49_65309
    LNRRRQTLAKSNSRKTNNHIMEEGNDSEMWNSFSNNYRQVQSVLDRNELLIQQVNENHRSRSHDSMVQNVGLIQELNGNISKVASLYSDFNTDFTTMVHQRKNGV