Gene Details:

  • Gene ID: A4A49_29975
  • Suggest Gene Name: AGAMOUS-LIKE 15
  • Description: putative flowering gene
  • Species: Nicotiana attenuata
  • Source: Putative flowering gene from PlantCFG

Protein Features:

Functional Descriptions:

  • AGL15 (AGAMOUS-Like 15) is a member of the MADS domain family of regulatory factors. Although AGL15 is preferentially expressed during embryogenesis, AGL15 is also expressed in leaf primordia, shoot apical meristems and young floral buds, suggesting that AGL15 may play a role during post-germinative development. Transgenic plants that ectopically express AGL15 show delays in the transition to flowering, perianth abscission and senescence and fruit and seed maturation. Role in embryogenesis and gibberellic acid catabolism. Targets B3 domain transcription factors that are key regulators of embryogenesis.

Homologous

Sequences:

CDS Sequence
  • >A4A49_29975
    ATGGGAAGGAAGAAAGTGGAAATAAAGCGGATCGAAGACAGGAGTAGTAGGCAAGCGACTTTCTCGAAACGCAGAAGCGGACTGATGAAGAAAGCCAATCAGCTCTCTATTCTCTGTGACGTTGATATCGCCGTCGTCGTCTTCTCTAGCCGTGGACGCCTCTTTGAATTCTCCAGTACTAACAGGTTCCTTCTTCTTTTCCCAAACAAAGAAATTACTCTATTTTGTGTTGTATTTATCTGA
Protein Sequence
  • >A4A49_29975
    MGRKKVEIKRIEDRSSRQATFSKRRSGLMKKANQLSILCDVDIAVVVFSSRGRLFEFSSTNRFLLLFPNKEITLFCVVFI