Gene Details:
- Gene ID: A4A49_23143
- Suggest Gene Name: SUPPRESSOR OF OVEREXPRESSION OF CO 1 , AGAMOUS-LIKE 20;Time of flowering 18
- Description: putative flowering gene
- Species: Nicotiana attenuata
- Source: Putative flowering gene from PlantCFG
Protein Features:
Functional Descriptions:
- Controls flowering and is required for CO to promote flowering. It acts downstream of FT. Overexpression of (SOC1) AGL20 suppresses not only the late flowering of plants that have functional FRI and FLC alleles but also the delayed phase transitions during the vegetative stages of development. AGL20/SOC1 acts with AGL24 to promote flowering and inflorescence meristem identity.AGL20 upregulates expression of AGL24 in response to GA.;Suppressor of Overexpression of Constans 1
Homologous
- Arabidopsis thaliana — AT2G45660
- Glycine max — Glyma.18G224500
Sequences:
CDS Sequence
- >A4A49_23143
ATGGTGAGAGGAAAAACTCAGATGAGGCGTATAGAGAACGCGACAAGCAGGCAAGTTACTTTCTCTAAACGCAGAAATGGTTTGCTAAAGAAAGCATTTGAACTTTCAGTACTTTGTGATGCTGAGGTTGGTTTGGTTATTTTTTCTCCAAGAGGAAAGCTCTATGAATTTGCCAGCTCTAGGAAGGCCATACTCTTGGGCTGTTTCCTTTGTAACAAACCTTGA
Protein Sequence
- >A4A49_23143
MVRGKTQMRRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVIFSPRGKLYEFASSRKAILLGCFLCNKP