Gene Details:
- Gene ID: A4A49_17619
- Suggest Gene Name: EARLY FLOWERING 4
- Description: putative flowering gene
- Species: Nicotiana attenuata
- Source: Putative flowering gene from PlantCFG
Protein Features:
- Pfam: PF07011
Functional Descriptions:
- Encodes a novel nuclear 111 amino-acid phytochrome-regulated component of a negative feedback loop involving the circadian clock central oscillator components CCA1 and LHY. ELF4 is necessary for light-induced expression of both CCA1 and LHY, and conversely, CCA1 and LHY act negatively on light-induced ELF4 expression. ELF4 promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles. It is involved in the phyB-mediated constant red light induced seedling de-etiolation process and may function to coregulate the expression of a subset of phyB-regulated genes.
Homologous
- Arabidopsis thaliana — AT2G40080
Sequences:
CDS Sequence
- >A4A49_17619
ATGGACGCTACCTCCCAAACCCTAACGAAGCTTTCCGACATCAGTAAGCACCGATTAAATGTCGACGAATTTAACGACGTAAAAGAGCAAGAGTATGACACGGAGGCTTGGGAAACACTTTCCAAGTGTTTCCGAGAGGTTCAATCTGTTCTAGATCGGAATCGAATTCTTATTCAACAGGTGAACGAAAATCATCAATCGATGCTTCCATATAATCTGGTGAAGAACGTAGCTCTTATTCGAGATATTAATCATAATATCTCCAAAATTTCCTGCCTTTACTCTGATCTCTCTGTAAATTTCTGCAATATCGTACATCAGCGACGAGCACTGGATTCGATGGAATCTAAGAATTACAACGGCAAAGCGGAGAGGCGCTGA
Protein Sequence
- >A4A49_17619
MDATSQTLTKLSDISKHRLNVDEFNDVKEQEYDTEAWETLSKCFREVQSVLDRNRILIQQVNENHQSMLPYNLVKNVALIRDINHNISKISCLYSDLSVNFCNIVHQRRALDSMESKNYNGKAERR