pikh;pi54

Gene Details

MSU gene ID: LOC_Os11g42010
RAPdb gene ID: Os11g0639100
Gene Symbol: pikh pi54 Pi-kh
Genome: MSU7 , IRGSP-1.0
Species: Oryza sativa

Functional Descriptions

The pi54 gene (Pi-k(h)) confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.
Detection of callose deposition in resistant plants containing Pi-k h (pi54) gene implicates its involvement in the initiation of defense response cascade.
In our effort to identify more effective forms of this gene, we isolated an orthologue of pi54 named as pi54rh from the blast-resistant wild species of rice, Oryza rhizomatis, using allele mining approach and validated by complementation.
The blast resistance candidate gene Pi-k h (pi54) was cloned into a plant transformation vector and the construct was used to transform a japonica cultivar of rice Taipei 309, which is susceptible to M.
Functional complementation of rice blast resistance gene Pi-k h (pi54) conferring resistance to diverse strains of Magnaporthe oryzae.
The single functional blast resistance gene pi54 activates a complex defence mechanism in rice.
The dominant rice blast resistance gene, pi54 confers resistance to Magnaporthe oryzae in different parts of India.
A novel blast resistance gene, pi54rh cloned from wild species of rice, Oryza rhizomatis confers broad spectrum resistance to Magnaporthe oryzae.
In this study, for the first time, we demonstrated that a rice blast resistance gene pi54rh cloned from wild species of rice provides broad spectrum resistance to M.
The pi54rh belongs to CC-NBS-LRR family of disease resistance genes with a unique Zinc finger (C(3)H type) domain.
This study suggests the activation of defence response and transcription factor-related genes and a higher expression of key enzymes involved in the defence response pathway in the rice line TP-pi54, thus leading to incompatible host-pathogen interaction.
The transgenic lines containing pi54 gene have higher tiller number, grain weight, epicotyl length, and yield compared to the non-transgenic control.
Phenotypic expression of blast resistance gene pi54 is not affected by its chromosomal position.
This is a novel report in which chromosomal position of the rice blast resistance gene pi54 was not found to affect significantly the resistance phenotype or morphological traits.
Three different transgenic lines containing pi54 and its orthologue pi54rh were shown to be resistant to different races of M.
These results will facilitate precise utilization of pi54 gene and its orthologue in breeding programs for the development of rice cultivars with broad spectrum and durable resistance to M.
pi54 gene imparts resistance against M.
Extensive sequence variation in rice blast resistance gene pi54 makes it broad spectrum in nature.
This is a maiden report of extensive variability of pi54 alleles in different landraces and cultivated varieties, possibly, attributing broad-spectrum resistance to Magnaporthe oryzae.
Rice blast resistant gene, pi54 cloned from rice line, Tetep, is effective against diverse isolates of Magnaporthe oryzae.
High quality sequences were generated for homologs of pi54 gene.
The rice blast resistance gene pi54 initially identified in an Indian cultivar confers broad-spectrum resistance in India.
Together, the newly identified pi54 alleles expand the allelic series and are candidates for rice blast resistance breeding programs.
We explored the allelic diversity of the pi54 gene among 885 Indian rice genotypes that were found resistant in our screening against field mixture of naturally existing M.
The objective of this study was to determine the effects (through over-expressing and using the CaMV 35S promoter) of pikh on MR219 resistance because it is a rice variety that is susceptible to the blast fungus pathotype P7.
This study successfully clarified that over-expression of the pikh gene in transgenic plants can improve their blast resistance against the M.
Over-Expression of the pikh Gene with a CaMV 35S Promoter Leads to Improved Blast Disease (Magnaporthe oryzae) Tolerance in Rice.
brachyantha was on the root of both pi54 and #11 alleles.
Divergent evolution of rice blast resistance pi54 locus in the genus Oryza.
The rice blast resistance gene pi54 was cloned from Oryza sativa ssp.
Two divergent structures of pi54 locus caused by a mobile unit containing the nearby R-gene cluster could be developed before domestication.
In BC3F3 generation, the improved pyramided lines carrying a total of seven genes/QTLs (xa5 + xa13 + Xa21 + pi54 + qSBR7-1 + qSBR11-1 + qSBR11-2) were selected through molecular and phenotypic assay, and these were evaluated for resistance against bacterial blight, blast, and sheath blight pathogens under greenhouse conditions.

Functional Keywords

Literature and News

Gene Resources

Homologs

Sequences

cDNA Sequence

>LOC_Os11g42010.1
ATGGCAAAACTTCAAGAGAAAGAAAAGCTCGAGACATTGATGTTGAGGTGGAATATGGATGCTGGAAATGCCAGTAGAATAGATCATGAAGTACTTGAAACCCTCCAACCTAACCAGTGCCTGAAAACTTTGGAGATTGTTGCGTATGAAGGACATGCATTTCCATCTTGGATAACAAGCACTGAGCCATATCTCACATCTCTGGTTGAGATAAGCCTTGAAGTCTGGGAACAGTCATCTAGGATGAATCTGTTTCCTCGTCTTGCAGAACTTGTCATCATTCAGTGCCCAAAATTGAGAGCACTGCATATGGAGTTTCCATCGATTGAAAAATTGATTTTGTGGATGAATAATAAGATGTTGTACAGCTCGAAGGAAGGTCTGAGAGGTGTAGAGAAGAGCCTCGAAAATCTTTCAATTTCTTTCTGTGAAGAGTTGCATGCTTCTTCAGGCTGTGAGGGTCTACAGGCTCTTGATCGCCTCAAGAAGTTGGAGATATGTGGTTGTCATGAATTGTCATGCCTCCCACAGGGTTTGCAGCATCTTTCCTCTCTCGCCAGCTTGAAAATTGATAACTGCAACAAATTGGAGATTTTGCCAGAATGGTTGGAGAACCTACCTTTTCTACAGATAATGTGTTTGTCTGGCTGTCCAATTCTGCACTCCATTCCTGAAGGCCTAACATGTAGCGACATTATTGTTGAATATTGCCCCAATTTTAAAGAACCATCAGGTATGTCATCAGTGCTCTGTTCATGGAAAGCCATGTTTCTGATTTTCATTGAGCTATTCTTAAAGCAATTGAACTAG

CDS Sequence

>LOC_Os11g42010.1
ATGGCAAAACTTCAAGAGAAAGAAAAGCTCGAGACATTGATGTTGAGGTGGAATATGGATGCTGGAAATGCCAGTAGAATAGATCATGAAGTACTTGAAACCCTCCAACCTAACCAGTGCCTGAAAACTTTGGAGATTGTTGCGTATGAAGGACATGCATTTCCATCTTGGATAACAAGCACTGAGCCATATCTCACATCTCTGGTTGAGATAAGCCTTGAAGTCTGGGAACAGTCATCTAGGATGAATCTGTTTCCTCGTCTTGCAGAACTTGTCATCATTCAGTGCCCAAAATTGAGAGCACTGCATATGGAGTTTCCATCGATTGAAAAATTGATTTTGTGGATGAATAATAAGATGTTGTACAGCTCGAAGGAAGGTCTGAGAGGTGTAGAGAAGAGCCTCGAAAATCTTTCAATTTCTTTCTGTGAAGAGTTGCATGCTTCTTCAGGCTGTGAGGGTCTACAGGCTCTTGATCGCCTCAAGAAGTTGGAGATATGTGGTTGTCATGAATTGTCATGCCTCCCACAGGGTTTGCAGCATCTTTCCTCTCTCGCCAGCTTGAAAATTGATAACTGCAACAAATTGGAGATTTTGCCAGAATGGTTGGAGAACCTACCTTTTCTACAGATAATGTGTTTGTCTGGCTGTCCAATTCTGCACTCCATTCCTGAAGGCCTAACATGTAGCGACATTATTGTTGAATATTGCCCCAATTTTAAAGAACCATCAGGTATGTCATCAGTGCTCTGTTCATGGAAAGCCATGTTTCTGATTTTCATTGAGCTATTCTTAAAGCAATTGAACTAG

Protein Sequence

>LOC_Os11g42010.1
MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTLEIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN*