Information report for D27
Gene Details
|
|
Functional Descriptions
- In addition, 2’-epi-5-deoxystrigol, an identified strigolactone in root exudates of rice seedlings, was undetectable in D27, and the phenotypes of D27 could be rescued by supplementation with GR24, a synthetic strigolactone analog.
- Our results demonstrate that D27 is involved in the MAX/RMS/D pathway, in which D27 acts as a new member participating in the biosynthesis of strigolactones.
- D27 encodes a novel iron-containing protein that localizes in chloroplasts and is expressed mainly in vascular cells of shoots and roots.
- Moreover, D10 expression is upregulated in six branching mutants, d3, d10, d14, d17, D27 and high tillering dwarf (htd1).
- In rice (Oryza sativa), the plastid-localized protein DWARF27 (OsD27) is also necessary for SL biosynthesis, but the equivalent gene in Arabidopsis has not been identified.
- Using reverse genetics, we show that AtD27 is required for the inhibition of secondary bud outgrowth and that exogenous application of the synthetic SL GR24 can rescue the increased branching phenotype of an AtD27 mutant.
- The phenotype of D27 is correlated with enhanced polar auxin transport.
- We report here the molecular genetic characterization of D27, a classic rice mutant exhibiting increased tillers and reduced plant height.
- Biochemical Characterisation & Selective Inhibition of β-Carotene cis-trans-Isomerase D27 and Carotenoid Cleavage Dioxygenase CCD8 on the Strigolactone Biosynthetic Pathway.
Functional Keywords
Literature and News
- DWARF10, an RMS1/MAX4/DAD1 ortholog, controls lateral bud outgrowth in rice . DOI: 10.1111/j.1365-313X.2007.03210.x ; PMID: 17655651
- DWARF27, an iron-containing protein required for the biosynthesis of strigolactones, regulates rice tiller bud outgrowth . DOI: 10.1105/tpc.109.065987 ; PMID: 19470589
- Strigolactone biosynthesis in Medicago truncatula and rice requires the symbiotic GRAS-type transcription factors NSP1 and NSP2 . DOI: 10.1105/tpc.111.089771 ; PMID: 22039214
- The Arabidopsis ortholog of rice DWARF27 acts upstream of MAX1 in the control of plant development by strigolactones . DOI: 10.1104/pp.112.196253 ; PMID: 22623516
- Biochemical characterization and selective inhibition of β-carotene cis-trans isomerase D27 and carotenoid cleavage dioxygenase CCD8 on the strigolactone biosynthetic pathway . DOI: 10.1111/febs.13400 ; PMID: 26257333
- On the substrate specificity of the rice strigolactone biosynthesis enzyme DWARF27 . DOI: 10.1007/s00425-016-2487-5 ; PMID: 26945857
- Characterization of dwarf and narrow leaf (dnl-4) mutant in rice . DOI: 10.1080/15592324.2020.1849490 ; PMID: 33300429
Sequences
cDNA Sequence
- >LOC_Os11g37620.1
ATGGAGAATTCAGCTAACCCGAACATCACTAACATCGCAATATTCTCCTTCCGCGCCCTTCACATCAGCTACTTCCACCACCTCCCATGTTTCAAAGGAGCTGCAAGCACTTCCTCTCTGGCAGCACTTCCTCATCTCAAGGAGTTGCAAATGTTGCATCATCTCAAGGAGCTGGCAGCCGTAGCCGGTATACACATGATCCTCATCTACCTCTGCCGCTTTCTCCTCCGCCGCAGCCGCAACGTATTATTCACCGTTTCCAACAGCCTCCGTTTTCGCCTCAAGGTATTAACTGTATTGTTGTACATATGTCTCTCGGTCATGCTGTTCTACCTGTTTGGCTCCATCATGCCGCTGCCGCCGTGGGGCCTCGTGGTCGGTTGGGTCATGGCCCTCATCGCCGTCGAGCTCGCCTACGCCTTCATCTTTCCATATAGCTTTCGCTACATCGCTGACAACGACGACGACAAGATGGTTATTCTCCCTGTTTAA
CDS Sequence
- >LOC_Os11g37620.1
ATGGAGAATTCAGCTAACCCGAACATCACTAACATCGCAATATTCTCCTTCCGCGCCCTTCACATCAGCTACTTCCACCACCTCCCATGTTTCAAAGGAGCTGCAAGCACTTCCTCTCTGGCAGCACTTCCTCATCTCAAGGAGTTGCAAATGTTGCATCATCTCAAGGAGCTGGCAGCCGTAGCCGGTATACACATGATCCTCATCTACCTCTGCCGCTTTCTCCTCCGCCGCAGCCGCAACGTATTATTCACCGTTTCCAACAGCCTCCGTTTTCGCCTCAAGGTATTAACTGTATTGTTGTACATATGTCTCTCGGTCATGCTGTTCTACCTGTTTGGCTCCATCATGCCGCTGCCGCCGTGGGGCCTCGTGGTCGGTTGGGTCATGGCCCTCATCGCCGTCGAGCTCGCCTACGCCTTCATCTTTCCATATAGCTTTCGCTACATCGCTGACAACGACGACGACAAGATGGTTATTCTCCCTGTTTAA
Protein Sequence
- >LOC_Os11g37620.1
MENSANPNITNIAIFSFRALHISYFHHLPCFKGAASTSSLAALPHLKELQMLHHLKELAAVAGIHMILIYLCRFLLRRSRNVLFTVSNSLRFRLKVLTVLLYICLSVMLFYLFGSIMPLPPWGLVVGWVMALIAVELAYAFIFPYSFRYIADNDDDKMVILPV*