Gene Details:
- MSU gene ID: LOC_Os10g36160
- RAPdb gene ID: Os10g0505500
- Gene Symbol: OsLTPL159
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- The lipid transfer protein OsLTPL159 is involved in cold tolerance at the early seedling stage in rice.
- In addition, down-regulation of the expression of OsLTPL159 in the japonica variety ZH17 by RNA interference (RNAi) significantly decreased cold tolerance.
- Notably, overexpression of another allele, OsLTPL159GC2 , from the recipient parent Guichao 2 (GC2), an indica variety, did not improve cold tolerance, indicating that the variations in the OsLTPL159 coding region of GC2 might disrupt its function for cold tolerance.
- Further sequence comparison found that all 22 japonica varieties surveyed had an OsLTPL159 haplotype identical to IL112 and were more cold-tolerant than the surveyed indica varieties, implying that the variations in OsLTPL159 might be associated with differential cold tolerance of japonica and indica rice.
- Therefore, our findings suggest that the OsLTPL159 allele of japonica rice could be used to improve cold tolerance of indica rice through a molecular breeding strategy.
Function-related keywords:
- seedling , tolerance , cold-tolerance , R-protein , breeding
Literature:
- The lipid transfer protein OsLTPL159 is involved in cold tolerance at the early seedling stage in rice . DOI: 10.1111/pbi.13243 ; PMID: 31469486
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os10g36160.1
ACACCACCACATCGATAACATTCGATCACATTCGGCTAGTAACCAAGCAGTTCTTACGCTAGAGCTAGCTCGAGCAATGGTGAAGTGGGCAGCTGTGATGGAGATGCTTCTGCTGACGGCAGCAGCGACGGCGGTAGCGGTGGTGGCGGCGCAGTGTGACCCTGAGCAGCTATCGGCGTGCGTGAGCCCGATCTTCTACGGGACGGCGCCATCAGAGTCGTGCTGCTCCAACCTACGCGCACAGCAGAAGGAGGGGTGCCTCTGCCAGTACGCGAAAGACCCGACGTACGCGTCCTACGTCAACAACACCAACGCACGCAAGACCATCGCCGCCTGCGGCATCCCCATTCCCAGCTGCTAGGCTCGATCTCCCGCCGCCGCCGGCCATGATGCGTACGTGGCATATATACGCGTGGTGTGTACGTGCGCTTGAAGAAAAGGGCGTGAGTTTGAATTAATAATTATCCAGTACGCGATGTTTGATCGATCGATGATGTGCCTTTTTTTTTTGGTATTTGAAGTTTGAACTCTGAATTTCATCTTGTGTTAATTGGAGTATGATAGCTGTGTGTACATTCGTTTTGGAGGTAGAGGCCGGTTTAATTCA
CDS Sequence
- >LOC_Os10g36160.1
ATGGTGAAGTGGGCAGCTGTGATGGAGATGCTTCTGCTGACGGCAGCAGCGACGGCGGTAGCGGTGGTGGCGGCGCAGTGTGACCCTGAGCAGCTATCGGCGTGCGTGAGCCCGATCTTCTACGGGACGGCGCCATCAGAGTCGTGCTGCTCCAACCTACGCGCACAGCAGAAGGAGGGGTGCCTCTGCCAGTACGCGAAAGACCCGACGTACGCGTCCTACGTCAACAACACCAACGCACGCAAGACCATCGCCGCCTGCGGCATCCCCATTCCCAGCTGCTAG
Protein Sequence
- >LOC_Os10g36160.1
MVKWAAVMEMLLLTAAATAVAVVAAQCDPEQLSACVSPIFYGTAPSESCCSNLRAQQKEGCLCQYAKDPTYASYVNNTNARKTIAACGIPIPSC*