Gene Details:
- MSU gene ID: LOC_Os08g34258
- RAPdb gene ID: Os08g0441300
- Gene Symbol: Osmtd1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- A T-DNA insertion mutant Osmtd1 aas altered in architecture by upregulating MicroRNA156f in rice.
- Here, we identified a T-DNA insertion mutant Osmtd1 (Oryza sativa multi-tillering and dwarf mutant).
- Moreover, we revealed that Osmtd1 not only influences rice tiller number and leaf angle, but also represses pri-miR156f transcription in the CNV region.
- The Copy Number Variation of Osmtd1 Regulates Rice Plant Architecture.
Function-related keywords:
- architecture , dwarf , leaf , tiller , plant-architecture , tiller-number , leaf-angle
Literature:
- The alteration in the architecture of a T-DNA insertion rice mutant osmtd1 is caused by up-regulation of MicroRNA156f . DOI: 10.1111/jipb.12340 ; PMID: 25677853
- The Copy Number Variation of OsMTD1 Regulates Rice Plant Architecture . DOI: 10.3389/fpls.2020.620282 ; PMID: 33643334
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os08g34258.1
ATGAGCCAGAAGTCGTCGTGGCCGGAGCTGGTGGGCGTACTGGCGACGCTGGCGGCGACGCAGATCGGCAAGGACAGGCCGGACGTCGCCGTCGAGGTGCTCCCGCCGGGCGCGCCCCTCACGCCGGATTTCAACGACAAGCGCGTCCGTGTCTTCATGGACGACAACGGCATCGTCTTCAAAATTCCCGTCATCGGTTAG
CDS Sequence
- >LOC_Os08g34258.1
ATGAGCCAGAAGTCGTCGTGGCCGGAGCTGGTGGGCGTACTGGCGACGCTGGCGGCGACGCAGATCGGCAAGGACAGGCCGGACGTCGCCGTCGAGGTGCTCCCGCCGGGCGCGCCCCTCACGCCGGATTTCAACGACAAGCGCGTCCGTGTCTTCATGGACGACAACGGCATCGTCTTCAAAATTCCCGTCATCGGTTAG
Protein Sequence
- >LOC_Os08g34258.1
MSQKSSWPELVGVLATLAATQIGKDRPDVAVEVLPPGAPLTPDFNDKRVRVFMDDNGIVFKIPVIG*