Information report for ZFP245
Gene Details
|
|
Functional Descriptions
- Overproduction of ZFP245 enhanced the activities of reactive oxygen species-scavenging enzymes under stress conditions and increased the tolerance of rice seedlings to oxidative stress.
- However, ZFP245 was not regulated by high salt or abscisic acid treatment.
- The semi-quantitative-RT-PCR assay revealed ZFP245 was strongly induced after 6 h exposure to cold and drought stresses, and then reduced to the baseline.
- Taken together, ZFP245, as the first identified C2H2-type zinc finger protein involved in stress response in monocots probably plays a role as a transcription regulator in plant cold and drought responses through an ABA-independent pathway.
- A C2H2-type zinc finger protein gene ZFP245 was cloned by RT-PCR approach from cold treated rice seedlings.
- Our data suggest that ZFP245 may contribute to the tolerance of rice plants to cold and drought stresses by regulating proline levels and reactive oxygen species-scavenging activities, and therefore may be useful for developing transgenic crops with enhanced tolerance to abiotic stress.
- ZFP245 is a cold- and drought-responsive gene that encodes a zinc finger protein in rice.
- Transgenic rice plants overexpressing ZFP245 were generated and found to display high tolerance to cold and drought stresses.
- Increased tolerance of rice to cold, drought and oxidative stresses mediated by the overexpression of a gene that encodes the zinc finger protein ZFP245.
- Tissue expression analysis showed that ZFP245 was constitutively expressed in various rice tissues including roots, stems, leaves and spikes.
Functional Keywords
- seedling , salt , drought , abiotic-stress , transcription-regulator , stem , oxidative , root
Literature and News
- Increased tolerance of rice to cold, drought and oxidative stresses mediated by the overexpression of a gene that encodes the zinc finger protein ZFP245 . DOI: 10.1016/j.bbrc.2009.09.032 ; PMID: 19751706
- Identification of a rice zinc finger protein whose expression is transiently induced by drought, cold but not by salinity and abscisic acid . DOI: 10.1080/10425170500061590 ; PMID: 16147864
Gene Resources
- UniProt: Q84Z14
- EMBL: AP014963, AY395294
- AlphaFoldDB: Q84Z14
- EnsemblPlants: Os07t0588700-01
- Gramene: Os07t0588700-01
- KEGG: osa:4343765
- Orthologous matrix: HYVCGVE
Homologs
- Actinidia chinensis: Achn261701
- Brachypodium distachyon: Bradi1g22940.1.p
- Glycine max: Glyma.04G044900.1.p
- Nicotiana tabacum: XP_016467050.1
- Setaria italica: Seita.2G373600.1.p
- Setaria viridis: Sevir.2G384600.1.p
- Triticum aestivum: Traes_2BS_DD07C2EE6.2
Sequences
cDNA Sequence
- >LOC_Os07g39970.1
GTCGATTTCATACCACTATGGGGCTAAACGAGAAGCCATTGGTGCCTCCGTTGTCTCCAACGCCGGTGGACTTCCGAGCCCATCAGGTGTTCCCATCCAAGCACCACGATTTTGACACTAGCAAGAGTCGTAACATCTCTGGTAGTGTCGCCATCGGCAGTGATTCTGAGGAGGAGTACTTGGCGACTTCTCTCTTGATGCTCGCACATGGCATTCGGGACGAGACCAAGGACATCCGAGGGATGGGAGACGTAAAAGGTGTGGGTGTTGACACTTTGGAGCTGGTGAAACCAAGCCAACGGGCTTATGAGTGCTCGGTGTGTGGCAAGGTGTACTGGTGTTACCAGGCGTTGGGTGGGCACATGACGTGCCACCGCAACCTATTTGCACAAGTGGTGGCCGGTGATGAGTTGTCCTCCGATAGGACCATGGTGGTTAAGGGGCACAAGTGCTCTATCTGTCGCCTTGAGTTCCCATCTGGGCAGGCGCTAGGAGGACACATGCGGGTGCACTATGTGGGTGGTGTTGAAGGAGGCTCTGTCAAGGAGAAGAACGTTGTGAAGACCAAGGTTACAGGAGCACTGAAGCTAGTGTTGAAAGACTTTGACCTGAACGTGCCTGTTGTGGCAACGATGGTGGGAGACGAGGCTGAGAGCTCACATTCAGAGGCCAAAGCGCGGATGATGACACTCCCCTAACCAGCGCAATACTT
CDS Sequence
- >LOC_Os07g39970.1
ATGGGGCTAAACGAGAAGCCATTGGTGCCTCCGTTGTCTCCAACGCCGGTGGACTTCCGAGCCCATCAGGTGTTCCCATCCAAGCACCACGATTTTGACACTAGCAAGAGTCGTAACATCTCTGGTAGTGTCGCCATCGGCAGTGATTCTGAGGAGGAGTACTTGGCGACTTCTCTCTTGATGCTCGCACATGGCATTCGGGACGAGACCAAGGACATCCGAGGGATGGGAGACGTAAAAGGTGTGGGTGTTGACACTTTGGAGCTGGTGAAACCAAGCCAACGGGCTTATGAGTGCTCGGTGTGTGGCAAGGTGTACTGGTGTTACCAGGCGTTGGGTGGGCACATGACGTGCCACCGCAACCTATTTGCACAAGTGGTGGCCGGTGATGAGTTGTCCTCCGATAGGACCATGGTGGTTAAGGGGCACAAGTGCTCTATCTGTCGCCTTGAGTTCCCATCTGGGCAGGCGCTAGGAGGACACATGCGGGTGCACTATGTGGGTGGTGTTGAAGGAGGCTCTGTCAAGGAGAAGAACGTTGTGAAGACCAAGGTTACAGGAGCACTGAAGCTAGTGTTGAAAGACTTTGACCTGAACGTGCCTGTTGTGGCAACGATGGTGGGAGACGAGGCTGAGAGCTCACATTCAGAGGCCAAAGCGCGGATGATGACACTCCCCTAA
Protein Sequence
- >LOC_Os07g39970.1
MGLNEKPLVPPLSPTPVDFRAHQVFPSKHHDFDTSKSRNISGSVAIGSDSEEEYLATSLLMLAHGIRDETKDIRGMGDVKGVGVDTLELVKPSQRAYECSVCGKVYWCYQALGGHMTCHRNLFAQVVAGDELSSDRTMVVKGHKCSICRLEFPSGQALGGHMRVHYVGGVEGGSVKEKNVVKTKVTGALKLVLKDFDLNVPVVATMVGDEAESSHSEAKARMMTLP*