Gene Details:
- MSU gene ID: LOC_Os07g39970
- RAPdb gene ID: Os07g0588700
- Gene Symbol: ZFP245
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Overproduction of ZFP245 enhanced the activities of reactive oxygen species-scavenging enzymes under stress conditions and increased the tolerance of rice seedlings to oxidative stress.
- However, ZFP245 was not regulated by high salt or abscisic acid treatment.
- The semi-quantitative-RT-PCR assay revealed ZFP245 was strongly induced after 6 h exposure to cold and drought stresses, and then reduced to the baseline.
- Taken together, ZFP245, as the first identified C2H2-type zinc finger protein involved in stress response in monocots probably plays a role as a transcription regulator in plant cold and drought responses through an ABA-independent pathway.
- A C2H2-type zinc finger protein gene ZFP245 was cloned by RT-PCR approach from cold treated rice seedlings.
- Our data suggest that ZFP245 may contribute to the tolerance of rice plants to cold and drought stresses by regulating proline levels and reactive oxygen species-scavenging activities, and therefore may be useful for developing transgenic crops with enhanced tolerance to abiotic stress.
- ZFP245 is a cold- and drought-responsive gene that encodes a zinc finger protein in rice.
- Transgenic rice plants overexpressing ZFP245 were generated and found to display high tolerance to cold and drought stresses.
- Increased tolerance of rice to cold, drought and oxidative stresses mediated by the overexpression of a gene that encodes the zinc finger protein ZFP245.
- Tissue expression analysis showed that ZFP245 was constitutively expressed in various rice tissues including roots, stems, leaves and spikes.
Function-related keywords:
- seedling , salt , drought , abiotic-stress , transcription-regulator , stem , oxidative , root
Literature:
- Increased tolerance of rice to cold, drought and oxidative stresses mediated by the overexpression of a gene that encodes the zinc finger protein ZFP245 . DOI: 10.1016/j.bbrc.2009.09.032 ; PMID: 19751706
- Identification of a rice zinc finger protein whose expression is transiently induced by drought, cold but not by salinity and abscisic acid . DOI: 10.1080/10425170500061590 ; PMID: 16147864
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os07g39970.1
GTCGATTTCATACCACTATGGGGCTAAACGAGAAGCCATTGGTGCCTCCGTTGTCTCCAACGCCGGTGGACTTCCGAGCCCATCAGGTGTTCCCATCCAAGCACCACGATTTTGACACTAGCAAGAGTCGTAACATCTCTGGTAGTGTCGCCATCGGCAGTGATTCTGAGGAGGAGTACTTGGCGACTTCTCTCTTGATGCTCGCACATGGCATTCGGGACGAGACCAAGGACATCCGAGGGATGGGAGACGTAAAAGGTGTGGGTGTTGACACTTTGGAGCTGGTGAAACCAAGCCAACGGGCTTATGAGTGCTCGGTGTGTGGCAAGGTGTACTGGTGTTACCAGGCGTTGGGTGGGCACATGACGTGCCACCGCAACCTATTTGCACAAGTGGTGGCCGGTGATGAGTTGTCCTCCGATAGGACCATGGTGGTTAAGGGGCACAAGTGCTCTATCTGTCGCCTTGAGTTCCCATCTGGGCAGGCGCTAGGAGGACACATGCGGGTGCACTATGTGGGTGGTGTTGAAGGAGGCTCTGTCAAGGAGAAGAACGTTGTGAAGACCAAGGTTACAGGAGCACTGAAGCTAGTGTTGAAAGACTTTGACCTGAACGTGCCTGTTGTGGCAACGATGGTGGGAGACGAGGCTGAGAGCTCACATTCAGAGGCCAAAGCGCGGATGATGACACTCCCCTAACCAGCGCAATACTT
CDS Sequence
- >LOC_Os07g39970.1
ATGGGGCTAAACGAGAAGCCATTGGTGCCTCCGTTGTCTCCAACGCCGGTGGACTTCCGAGCCCATCAGGTGTTCCCATCCAAGCACCACGATTTTGACACTAGCAAGAGTCGTAACATCTCTGGTAGTGTCGCCATCGGCAGTGATTCTGAGGAGGAGTACTTGGCGACTTCTCTCTTGATGCTCGCACATGGCATTCGGGACGAGACCAAGGACATCCGAGGGATGGGAGACGTAAAAGGTGTGGGTGTTGACACTTTGGAGCTGGTGAAACCAAGCCAACGGGCTTATGAGTGCTCGGTGTGTGGCAAGGTGTACTGGTGTTACCAGGCGTTGGGTGGGCACATGACGTGCCACCGCAACCTATTTGCACAAGTGGTGGCCGGTGATGAGTTGTCCTCCGATAGGACCATGGTGGTTAAGGGGCACAAGTGCTCTATCTGTCGCCTTGAGTTCCCATCTGGGCAGGCGCTAGGAGGACACATGCGGGTGCACTATGTGGGTGGTGTTGAAGGAGGCTCTGTCAAGGAGAAGAACGTTGTGAAGACCAAGGTTACAGGAGCACTGAAGCTAGTGTTGAAAGACTTTGACCTGAACGTGCCTGTTGTGGCAACGATGGTGGGAGACGAGGCTGAGAGCTCACATTCAGAGGCCAAAGCGCGGATGATGACACTCCCCTAA
Protein Sequence
- >LOC_Os07g39970.1
MGLNEKPLVPPLSPTPVDFRAHQVFPSKHHDFDTSKSRNISGSVAIGSDSEEEYLATSLLMLAHGIRDETKDIRGMGDVKGVGVDTLELVKPSQRAYECSVCGKVYWCYQALGGHMTCHRNLFAQVVAGDELSSDRTMVVKGHKCSICRLEFPSGQALGGHMRVHYVGGVEGGSVKEKNVVKTKVTGALKLVLKDFDLNVPVVATMVGDEAESSHSEAKARMMTLP*