Gene Details:

Functional Descriptions:

  • Overproduction of ZFP245 enhanced the activities of reactive oxygen species-scavenging enzymes under stress conditions and increased the tolerance of rice seedlings to oxidative stress.
  • However, ZFP245 was not regulated by high salt or abscisic acid treatment.
  • The semi-quantitative-RT-PCR assay revealed ZFP245 was strongly induced after 6 h exposure to cold and drought stresses, and then reduced to the baseline.
  • Taken together, ZFP245, as the first identified C2H2-type zinc finger protein involved in stress response in monocots probably plays a role as a transcription regulator in plant cold and drought responses through an ABA-independent pathway.
  • A C2H2-type zinc finger protein gene ZFP245 was cloned by RT-PCR approach from cold treated rice seedlings.
  • Our data suggest that ZFP245 may contribute to the tolerance of rice plants to cold and drought stresses by regulating proline levels and reactive oxygen species-scavenging activities, and therefore may be useful for developing transgenic crops with enhanced tolerance to abiotic stress.
  • ZFP245 is a cold- and drought-responsive gene that encodes a zinc finger protein in rice.
  • Transgenic rice plants overexpressing ZFP245 were generated and found to display high tolerance to cold and drought stresses.
  • Increased tolerance of rice to cold, drought and oxidative stresses mediated by the overexpression of a gene that encodes the zinc finger protein ZFP245.
  • Tissue expression analysis showed that ZFP245 was constitutively expressed in various rice tissues including roots, stems, leaves and spikes.

Literature:

Gene Resources:

Sequences:

cDNA Sequence
  • >LOC_Os07g39970.1
    GTCGATTTCATACCACTATGGGGCTAAACGAGAAGCCATTGGTGCCTCCGTTGTCTCCAACGCCGGTGGACTTCCGAGCCCATCAGGTGTTCCCATCCAAGCACCACGATTTTGACACTAGCAAGAGTCGTAACATCTCTGGTAGTGTCGCCATCGGCAGTGATTCTGAGGAGGAGTACTTGGCGACTTCTCTCTTGATGCTCGCACATGGCATTCGGGACGAGACCAAGGACATCCGAGGGATGGGAGACGTAAAAGGTGTGGGTGTTGACACTTTGGAGCTGGTGAAACCAAGCCAACGGGCTTATGAGTGCTCGGTGTGTGGCAAGGTGTACTGGTGTTACCAGGCGTTGGGTGGGCACATGACGTGCCACCGCAACCTATTTGCACAAGTGGTGGCCGGTGATGAGTTGTCCTCCGATAGGACCATGGTGGTTAAGGGGCACAAGTGCTCTATCTGTCGCCTTGAGTTCCCATCTGGGCAGGCGCTAGGAGGACACATGCGGGTGCACTATGTGGGTGGTGTTGAAGGAGGCTCTGTCAAGGAGAAGAACGTTGTGAAGACCAAGGTTACAGGAGCACTGAAGCTAGTGTTGAAAGACTTTGACCTGAACGTGCCTGTTGTGGCAACGATGGTGGGAGACGAGGCTGAGAGCTCACATTCAGAGGCCAAAGCGCGGATGATGACACTCCCCTAACCAGCGCAATACTT
CDS Sequence
  • >LOC_Os07g39970.1
    ATGGGGCTAAACGAGAAGCCATTGGTGCCTCCGTTGTCTCCAACGCCGGTGGACTTCCGAGCCCATCAGGTGTTCCCATCCAAGCACCACGATTTTGACACTAGCAAGAGTCGTAACATCTCTGGTAGTGTCGCCATCGGCAGTGATTCTGAGGAGGAGTACTTGGCGACTTCTCTCTTGATGCTCGCACATGGCATTCGGGACGAGACCAAGGACATCCGAGGGATGGGAGACGTAAAAGGTGTGGGTGTTGACACTTTGGAGCTGGTGAAACCAAGCCAACGGGCTTATGAGTGCTCGGTGTGTGGCAAGGTGTACTGGTGTTACCAGGCGTTGGGTGGGCACATGACGTGCCACCGCAACCTATTTGCACAAGTGGTGGCCGGTGATGAGTTGTCCTCCGATAGGACCATGGTGGTTAAGGGGCACAAGTGCTCTATCTGTCGCCTTGAGTTCCCATCTGGGCAGGCGCTAGGAGGACACATGCGGGTGCACTATGTGGGTGGTGTTGAAGGAGGCTCTGTCAAGGAGAAGAACGTTGTGAAGACCAAGGTTACAGGAGCACTGAAGCTAGTGTTGAAAGACTTTGACCTGAACGTGCCTGTTGTGGCAACGATGGTGGGAGACGAGGCTGAGAGCTCACATTCAGAGGCCAAAGCGCGGATGATGACACTCCCCTAA
Protein Sequence
  • >LOC_Os07g39970.1
    MGLNEKPLVPPLSPTPVDFRAHQVFPSKHHDFDTSKSRNISGSVAIGSDSEEEYLATSLLMLAHGIRDETKDIRGMGDVKGVGVDTLELVKPSQRAYECSVCGKVYWCYQALGGHMTCHRNLFAQVVAGDELSSDRTMVVKGHKCSICRLEFPSGQALGGHMRVHYVGGVEGGSVKEKNVVKTKVTGALKLVLKDFDLNVPVVATMVGDEAESSHSEAKARMMTLP*