Gene Details:
- MSU gene ID: LOC_Os07g39220
- RAPdb gene ID: Os07g0580500
- Gene Symbol: OsBZR1 BZR1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- These results demonstrate a conserved function of OsBZR1 and an important role of 14-3-3 proteins in brassinosteroid signal transduction in rice.
- Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice.
- To understand the downstream BR signaling mechanism in rice, we studied the function of OsBZR1 using reverse genetic approaches and identified OsBZR1-interacting proteins.
- Suppressing OsBZR1 expression by RNAi resulted in dwarfism, erect leaves, reduced BR sensitivity, and altered BR-responsive gene expression in transgenic rice plants, demonstrating an essential role of OsBZR1 in BR responses in rice.
- Finally, consistent with the fact that DLT is also negatively feedback-regulated by BR treatment, a gel mobility shift assay showed that OsBZR1 can bind to the DLT promoter through the BR-response element.
- We reported that DGS1 plays a positive role in regulating grain size in rice and was regulated by OsBZR1.
- OsBZR1 (BRASSINAZOLE-RESISTANT1), a core transcription activator of BR signaling, also plays a positive role in grain size.
- The histone deacetylase HDA703 interacts with OsBZR1 to regulate rice brassinosteroid signaling, growth and heading date through repression of Ghd7 expression.
- We further show that GRAIN NUMBER, PLANT HEIGHT, and HEADING DATE 7 (Ghd7), a central regulator of growth, development, and the stress response, is a direct target of OsBZR1.
- We also show that HDA703 is a direct target of BRASSINAZOLE-RESISTANT1 (OsBZR1), a primary regulator of rice BR signaling, and HDA703 interacts with OsBZR1 in rice.
- Together, our study suggests that HDA703, a histone H4 deacetylase, interacts with OsBZR1 to regulate rice BR signaling, growth, and heading date through epigenetic regulation of Ghd7.
- Moreover, cellular ammonium contents, 15NH4 + uptake, and the regulatory effect of methyl-ammonium on root growth are strongly dependent on the levels of BZR1.
- qGL3/OsPPKL1 Induces Phosphorylation of 14-3-3 OsGF14b to Inhibit OsBZR1 Function in Brassinosteroid Signaling.
- Genetic and molecular analyses indicated that OsGF14b functions as a negative regulator in BR signaling and represses the transcriptional activation activity of OsBZR1.
- OsGSK2 deacetylation attenuated the interaction between OsGSK2 and BRASSINAZOLE RESISTANT 1 (OsBZR1), leading to accumulation of OsBZR1.
- Although BZR1 is known to regulate brassinosteroid (BR) signalling, the observation that BR signalling negatively regulated resistance to ShB indicated an independent role for BZR1 in controlling rice resistance.
- Plants overexpressing PIL15 were more susceptible to ShB in contrast to BZR1-D-overexpressing plants compared with the wild-type, suggesting that PhyB may inhibit BZR1 to negatively regulate rice resistance to ShB.
- It was also found that the BZR1 ligand NAC028 positively regulated resistance to ShB.
Function-related keywords:
- brassinosteroid , BR , dwarf , BR-signaling , erect , grain , grain-size , transcription-activator , growth , grain-number , stress , heading-date , Brassinosteroid , plant-height , Brassinosteroid-Signaling , stress-response , root , root-growth , resistant , resistance
Literature:
- DWARF AND LOW-TILLERING, a new member of the GRAS family, plays positive roles in brassinosteroid signaling in rice . DOI: 10.1111/j.1365-313X.2009.03825.x ; PMID: 19220793
- Dynamics of brassinosteroid response modulated by negative regulator LIC in rice . DOI: 10.1371/journal.pgen.1002686 ; PMID: 22570626
- Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice . DOI: 10.1073/pnas.0706386104 ; PMID: 17699623
- OsmiR396d Affects Gibberellin and Brassinosteroid Signaling to Regulate Plant Architecture in Rice . DOI: 10.1104/pp.17.00964 ; PMID: 29180380
- Strigolactones and Brassinosteroids Antagonistically Regulate the Stability of the D53-OsBZR1 Complex to Determine FC1 Expression in Rice Tillering . DOI: 10.1016/j.molp.2019.12.005 ; PMID: 31837469
- OrMKK3 Influences Morphology and Grain Size in Rice . DOI: 10.1007/s12374-020-09290-2 ; PMID: 33424241
- Decreased grain size1, a C3HC4-type RING protein, influences grain size in rice (Oryza sativa L.) . DOI: 10.1007/s11103-020-01096-7 ; PMID: 33387175
- The histone deacetylase HDA703 interacts with OsBZR1 to regulate rice brassinosteroid signaling, growth and heading date through repression of Ghd7 expression . DOI: 10.1111/tpj.14936 ; PMID: 33617099
- BZR1 Regulates Brassinosteroid-Mediated Activation of AMT1;2 in Rice . DOI: 10.3389/fpls.2021.665883 ; PMID: 34220889
- qGL3/OsPPKL1 induces phosphorylation of 14-3-3 protein OsGF14b to inhibit OsBZR1 function in brassinosteroid signaling . DOI: 10.1093/plphys/kiab484 ; PMID: 34662408
- GLUTAMATE RECEPTOR-like gene OsGLR3.4 is required for plant growth and systemic wound signaling in rice (Oryza sativa) . DOI: 10.1111/nph.17859 ; PMID: 34767648
- The histone deacetylase 1/GSK3/SHAGGY-like kinase 2/BRASSINAZOLE-RESISTANT 1 module controls lateral root formation in rice . DOI: 10.1093/plphys/kiac015 ; PMID: 35078247
- Red-light receptor phytochrome B inhibits BZR1-NAC028-CAD8B signaling to negatively regulate rice resistance to sheath blight . DOI: 10.1111/pce.14502 ; PMID: 36457051
- Mutation of phytochrome B promotes resistance to sheath blight and saline-alkaline stress via increasing ammonium uptake in rice . DOI: 10.1111/tpj.16046 ; PMID: 36440495
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os07g39220.1
CCTCGCCATTAAAGAAACTTGAGCTCGCCAAGTGGAGAAAGGAGAGGTGGAGGAGAGGAGGGGAGGGGAGGGGAGGTGAGGGACGGAGCTGGTGGGTATGACGTCCGGGGCGGCGGCGGCGGGGAGGACGCCGACGTGGAAGGAGAGGGAGAACAACAAGAGGCGGGAGCGGCGGCGGCGTGCCATCGCCGCCAAGATCTTCACGGGGCTCCGGGCGCTCGGGAACTACAACCTCCCCAAGCACTGCGACAACAACGAGGTGCTCAAGGCGCTCTGCCGCGAGGCCGGCTGGGTTGTCGAGGACGACGGCACCACCTACCGCAAGGGATGTAAGCCGCCGCCATCGTCGGCTGGGGGAGCGTCGGTGGGGATGAGCCCCTGCTCGTCAACGCAGCTGCTGAGCGCGCCGTCGTCGTCGTTCCCGAGCCCGGTGCCGTCGTACCACGCGAGCCCGGCGTCGTCGAGCTTCCCGAGCCCCAGCCGGATCGACAACCCGAGCGCCTCCTGCCTCCTCCCGTTCCTCCGGGGGCTCCCCAACCTCCCGCCGCTCCGCGTCTCCAGCAGCGCGCCCGTCACGCCGCCGCTCTCGTCGCCGACGGCGTCGCGGCCGCCCAAGATCAGGAAGCCGGACTGGGACGTCGACCCGTTCCGGCACCCCTTCTTCGCGGTCTCCGCGCCGGCGAGCCCCACCCGCGGCCGCCGCCTCGAGCACCCGGACACGATACCGGAGTGCGACGAGTCCGACGTCTCCACGGTGGACTCCGGCCGGTGGATCAGCTTCCAGATGGCCACGACGGCGCCGACGTCGCCCACCTACAACCTCGTCAACCCGGGCGCCTCCACCTCCAACTCCATGGAGATAGAAGGGACGGCCGGCCGAGGCGGCGCGGAGTTCGAGTTCGACAAGGGGAGGGTGACGCCATGGGAGGGCGAGAGGATCCACGAGGTCGCCGCCGAGGAGCTCGAGCTCACGCTCGGCGTCGGCGCGAAATGACGGCCATTATTGCCGAGCAAAAAAGATGGTTCCTTTCGTGGACCTCGAGCACCAGCTGATCATGGTTGTTGTTAGATCAGTACTGGTCAATGTGTATGATCATGACTACGCATCGATGCTGCGATTTGGGCGATTTCATTCTAGCCTTAGGTTAATCTTGTTGTTCAATTCATTCTTCCTGGACTTGGGAAAAAGGAAGCAGGGAAAAATTGTTCATCACGGCTGATTTTATTCACGGCTTCACTGTTCATCTCTGTGTTTCTTCTTCCCGTACCTGTCATGTGCATCTCCTCAAAATGTGTGACATCTTAGCTTGTGAGTAGAGTGAGGTAAAAAAATGCGGGGGGAGATGATGTTCAACTTTATGGCATGATCGCTTTGACGTACCGTTAAACCAGTACAGTGAGCTCCCG
CDS Sequence
- >LOC_Os07g39220.1
ATGACGTCCGGGGCGGCGGCGGCGGGGAGGACGCCGACGTGGAAGGAGAGGGAGAACAACAAGAGGCGGGAGCGGCGGCGGCGTGCCATCGCCGCCAAGATCTTCACGGGGCTCCGGGCGCTCGGGAACTACAACCTCCCCAAGCACTGCGACAACAACGAGGTGCTCAAGGCGCTCTGCCGCGAGGCCGGCTGGGTTGTCGAGGACGACGGCACCACCTACCGCAAGGGATGTAAGCCGCCGCCATCGTCGGCTGGGGGAGCGTCGGTGGGGATGAGCCCCTGCTCGTCAACGCAGCTGCTGAGCGCGCCGTCGTCGTCGTTCCCGAGCCCGGTGCCGTCGTACCACGCGAGCCCGGCGTCGTCGAGCTTCCCGAGCCCCAGCCGGATCGACAACCCGAGCGCCTCCTGCCTCCTCCCGTTCCTCCGGGGGCTCCCCAACCTCCCGCCGCTCCGCGTCTCCAGCAGCGCGCCCGTCACGCCGCCGCTCTCGTCGCCGACGGCGTCGCGGCCGCCCAAGATCAGGAAGCCGGACTGGGACGTCGACCCGTTCCGGCACCCCTTCTTCGCGGTCTCCGCGCCGGCGAGCCCCACCCGCGGCCGCCGCCTCGAGCACCCGGACACGATACCGGAGTGCGACGAGTCCGACGTCTCCACGGTGGACTCCGGCCGGTGGATCAGCTTCCAGATGGCCACGACGGCGCCGACGTCGCCCACCTACAACCTCGTCAACCCGGGCGCCTCCACCTCCAACTCCATGGAGATAGAAGGGACGGCCGGCCGAGGCGGCGCGGAGTTCGAGTTCGACAAGGGGAGGGTGACGCCATGGGAGGGCGAGAGGATCCACGAGGTCGCCGCCGAGGAGCTCGAGCTCACGCTCGGCGTCGGCGCGAAATGA
Protein Sequence
- >LOC_Os07g39220.1
MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK*