Information report for OsGSR1;GW6
Gene Details
|
|
Functional Descriptions
- The yeast two-hybrid assay revealed that OsGSR1 interacts with DIM/DWF1, an enzyme that catalyzes the conversion from 24-methylenecholesterol to campesterol in BR biosynthesis.
- These results suggest that OsGSR1 activates BR synthesis by directly regulating a BR biosynthetic enzyme at the post-translational level.
- These results demonstrate that OsGSR1 plays important roles in both BR and GA pathways, and also mediates an interaction between the two signaling pathways.
- RNA interference (RNAi) transgenic rice plants with reduced OsGSR1 expression show phenotypes similar to plants deficient in BR, including short primary roots, erect leaves and reduced fertility.
- OsGSR1 is involved in crosstalk between gibberellins and brassinosteroids in rice.
- Here, we demonstrate that OsGSR1, a member of the GAST (GA-stimulated transcript) gene family, is induced by GA and repressed by BR.
- Furthermore, OsGSR1 RNAi plants show a reduced sensitivity to GA treatment, an increased expression of the GA biosynthetic gene OsGA20ox2, which is feedback inhibited by GA signaling, and an elevated level of endogenous GA: together, these suggest that OsGSR1 is a positive regulator of GA signaling.
- The OsGSR1 RNAi transgenic rice shows a reduced level of endogenous BR, and the dwarf phenotype could be rescued by the application of brassinolide.
- GW6 is highly expressed in the young panicle and increases grain width by promoting cell expansion in the spikelet hull.
- GW6 is induced by GA and its knockout down-regulates the expression of GA biosynthesis genes and decreases GA contents in the young panicle.
- A quantitative trait locus GW6 controls rice grain size and yield through the gibberellin pathway.
- Here, we report the cloning and characterization of a QTL, GW6 (GRAIN WIDTH 6), which encodes a gibberellin-regulated GAST family protein and positively regulates grain width and weight.
- The knockout of GW6 exhibits reduced grain size and weight, whereas the overexpression of GW6 results in increased grain size and weight.
- We found that a natural variation in the cis element CAAT-box in the promoter of GW6 is associated with its expression level and grain width and weight.
- 44% increase in rice grain yield, indicating that GW6 has great potential to improve grain yield in rice.
- Natural variation in OsGASR7 regulates grain length in rice.
Functional Keywords
- BR , root , brassinosteroid , ga , fertility , ethylene , dwarf , primary-root , gibberellin , erect , panicle , spikelet , grain , grain-yield , yield , grain-size , Gibberellin , GA , grain-width , GA-biosynthesis , grain-length
Literature and News
- OsGSR1 is involved in crosstalk between gibberellins and brassinosteroids in rice . DOI: 10.1111/j.1365-313X.2008.03707.x ; PMID: 18980660
- A quantitative trait locus GW6 controls rice grain size and yield through the gibberellin pathway . DOI: 10.1111/tpj.14793 ; PMID: 32365409
- Natural variation in OsGASR7 regulates grain length in rice . DOI: 10.1111/pbi.13436 ; PMID: 32569443
Gene Resources
- UniProt: Q53AN3
- EMBL: AP014962, AY604180
- AlphaFoldDB: Q53AN3
- EnsemblPlants: Os06t0266800-02
- Gramene: Os06t0266800-02
- KEGG: osa:4340712
- Orthologous matrix: GHHYNDK
- InterPro: IPR003854
- PANTHER: PTHR23201, PTHR23201:SF70
- OrthoDB: Q53AN3
- SWISS-MODEL: Q53AN3
- eggNOG: ENOG502S3SC
Sequences
cDNA Sequence
- >LOC_Os06g15620.1
TAAGTCCCTAACCCACCCAAACACCACCGCACCCACCAATGGCGTCCTCCACCAAGATCCCCTTCCTCCTCCTCGCCGTCCTCCTCCTCCTTTCCATCGCCTTCCCATCGGAGGTGATGGCAGGAGGGCGCGGGCGCGGCGGCGGCGGCGGCGGAGGGGTGGCCGGCGGCGGGAACCTGAGGCCGTGGGAGTGCTCGCCCAAGTGCGCGGGGAGGTGCTCCAACACGCAGTACAAGAAGGCGTGCCTGACGTTCTGCAACAAGTGCTGCGCCAAGTGCCTGTGCGTGCCGCCCGGCACCTACGGCAACAAGGGCGCCTGCCCCTGCTACAACAACTGGAAGACCAAGGAAGGCGGCCCCAAGTGCCCCTAAGATGCATGCCTTTTTTTCTTTCTTCTTTTTTTTTTGTTTTTTTACCGTATGATTAATACCTCCTACTAGTTCTACTACATTGGTGTGTCACTGCCTCACTGACACTGGTTTAGCTCATGGATCCGGTTGATTAGTTAATTGGTGGTGGGTTTTATTGCTAGATCTGGGCTTATAAGTATTAGTTTATCCTGTTCTAGTAAGGTTGTTGGTTGGGGGAATGTGTGCGAGAGAGGAGAGTGAGGATTCGTCAAAGCTGGTCAAAAACTTGGATCCCCTCTCCCTGTAGTGATTGATTGATTTGCTACTACTGGAGTGTGCTTTGCCGGAATCATTTGGTGCTCTGCTCACCCAGCATTGAAATTTGAGACAATGCTTAGTATACTTAAGTACTGGAGTAGTATAATTTCATTCGCAAGCTTTGTTGTGATCTTGTTGCGTGCACCCCCCGCGTGTTGAGCTCATCTCAAGAGATCGAATGGCTGTCTGCTTACCGATCAGTATCTTTTCTGTGCTGTGTACATCGATGTAGCCGGATTTTAATTCATTTTCTAAAAAGAAAATCAGTATCTTTTCTTTCTTCTTTTTCTTTCCTTCAATTAAGGTACGGCTGATTCCATGAGTTTTGTGCATATGGGCTGACCGAAACTAAGTTGGAATAAGTTCATTTGATA
CDS Sequence
- >LOC_Os06g15620.1
ATGGCGTCCTCCACCAAGATCCCCTTCCTCCTCCTCGCCGTCCTCCTCCTCCTTTCCATCGCCTTCCCATCGGAGGTGATGGCAGGAGGGCGCGGGCGCGGCGGCGGCGGCGGCGGAGGGGTGGCCGGCGGCGGGAACCTGAGGCCGTGGGAGTGCTCGCCCAAGTGCGCGGGGAGGTGCTCCAACACGCAGTACAAGAAGGCGTGCCTGACGTTCTGCAACAAGTGCTGCGCCAAGTGCCTGTGCGTGCCGCCCGGCACCTACGGCAACAAGGGCGCCTGCCCCTGCTACAACAACTGGAAGACCAAGGAAGGCGGCCCCAAGTGCCCCTAA
Protein Sequence
- >LOC_Os06g15620.1
MASSTKIPFLLLAVLLLLSIAFPSEVMAGGRGRGGGGGGGVAGGGNLRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNWKTKEGGPKCP*