Gene Details:
- MSU gene ID: LOC_Os06g12210
- RAPdb gene ID: Os06g0226500
- Gene Symbol: BU1 OsbHLH174
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- These results indicate that BU1 protein is a positive regulator of BR response: it controls bending of the lamina joint in rice and it is a novel primary response gene that participates in two BR signaling pathways through OsBRI1 and RGA1.
- Rice plants overexpressing BU1 (BU1:OX) showed enhanced bending of the lamina joint, increased grain size, and resistance to brassinazole, an inhibitor of BR biosynthesis.
- Consistently, transcriptome analyses revealed that SDG725 depletion results in down-regulation by more than two-fold of over 1000 genes, including D11, BRI1 and BU1, which are known to be involved in brassinosteroid biosynthesis or signaling pathways.
- In addition, compared to the wild type, the induction of BU1 by exogenous brassinolide did not require de novo protein synthesis and it was weaker in a BR receptor mutant OsbriI (Oryza sativa brassinosteroid insensitive1, d61) and a rice G protein alpha subunit (RGA1) mutant d1.
- These results indicate that BU1 may participate in some other unknown processes modulated by BR in rice.
- Furthermore, expression analyses showed that BU1 is expressed in several organs including lamina joint, phloem, and epithelial cells in embryos.
- In contrast to BU1:OX, RNAi plants designed to repress both BU1 and its homologs displayed erect leaves.
- Here, we describe a novel BR-induced rice gene BRASSINOSTEROID UPREGULATED1 (BU1), encoding a helix-loop-helix protein.
Function-related keywords:
- BR-signaling , grain , brassinosteroid , grain-size , BR , lamina , erect
Literature:
- H3K36 methylation is critical for brassinosteroid-regulated plant growth and development in rice . DOI: 10.1111/j.1365-313X.2011.04873.x ; PMID: 22136623
- BRASSINOSTEROID UPREGULATED1, encoding a helix-loop-helix protein, is a novel gene involved in brassinosteroid signaling and controls bending of the lamina joint in rice . DOI: 10.1104/pp.109.140806 ; PMID: 19648232
- Genome-wide association studies reveal that members of bHLH subfamily 16 share a conserved function in regulating flag leaf angle in rice (Oryza sativa) . DOI: 10.1371/journal.pgen.1007323 ; PMID: 29617374
- OrMKK3 Influences Morphology and Grain Size in Rice . DOI: 10.1007/s12374-020-09290-2 ; PMID: 33424241
Related News:
Gene Resources:
- NCBI ID: NM_001063738
- UniProt accessions:
Sequences:
cDNA Sequence
- >LOC_Os06g12210.1
ATGTCGAGCCGGAGGTCGTCGCGCTCCTCCGTGTCGGAGGAGGAGATCAACGAGCTCATCTCCAAGCTCCAGTCCCTCCTCCCCAGCTCCCGCCGCCGCGGCGCCAACCAGGCGTCGACGACGAAGCTGCTGAAGGAGACGTGCAGCTACATCAAGAGCCTGCACCGGGAGGTGGACGACCTCAGCGACAGGCTCTCCGACCTCATGGCCGGCATGGATCACAACAGCCCAGGCGCCGAGATCATCCGCAGCCTCCTCCGCTAG
CDS Sequence
- >LOC_Os06g12210.1
ATGTCGAGCCGGAGGTCGTCGCGCTCCTCCGTGTCGGAGGAGGAGATCAACGAGCTCATCTCCAAGCTCCAGTCCCTCCTCCCCAGCTCCCGCCGCCGCGGCGCCAACCAGGCGTCGACGACGAAGCTGCTGAAGGAGACGTGCAGCTACATCAAGAGCCTGCACCGGGAGGTGGACGACCTCAGCGACAGGCTCTCCGACCTCATGGCCGGCATGGATCACAACAGCCCAGGCGCCGAGATCATCCGCAGCCTCCTCCGCTAG
Protein Sequence
- >LOC_Os06g12210.1
MSSRRSSRSSVSEEEINELISKLQSLLPSSRRRGANQASTTKLLKETCSYIKSLHREVDDLSDRLSDLMAGMDHNSPGAEIIRSLLR*