Gene Details:

Functional Descriptions:

  • Herein, rice OsACBP2 was demonstrated not only to play a role in seed development and germination, but also to influence grain size.
  • When OsACBP2 function was investigated using OsACBP2 mutants and transgenic rice overexpressing OsACBP2 (OsACBP2-OE), OsACBP2 was retarded in germination, while OsACBP2-OEs performed better than the wild-type and vector-transformed controls, in germination, seedling growth, grain size, and grain weight.
  • Deletion analysis of the OsACBP2 5’-flanking region revealed five copies of the seed cis-element, Skn-I-like motif (-1486/-1482, -956/-952, -939/-935, -826/-822, and -766/-762), and the removal of any adversely affected expression in seeds, thereby providing a molecular basis for OsACBP2 expression in seeds.
  • As dietary rice bran contains beneficial bioactive components, OsACBP2 appears to be a promising candidate for enriching seed nutritional value.
  • OsACBP2 mRNA accumulated in embryos and endosperm of germinating seeds in qRT-PCR analysis, while β-glucuronidase (GUS) assays on OsACBP2pro::GUS rice transformants showed GUS expression in embryos, as well as the scutellum and aleurone layer of germinating seeds.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Sequences:

cDNA Sequence
  • >LOC_Os06g02490.1
    GGCGTCCATTGATCTTCCTCCCCCCTCCAACTCCAAGAAATCGACTGACGCCAACGAGAACGAGACGCCATCGCTGCCATGGGTTTGCAGGAGGAGTTTGAGGAGTTCGCCGAGAAGGCCAAGACCTTGCCTGACACAATTTCCAACGAGGACAAGCTGCTTCTCTATGGCCTCTACAAGCAGGCAACCGTTGGCCCGGTTACCACTGGGCGCCCAGGTATTTTCAACCTGAAAGACAGATACAAATGGGATGCTTGGAAGGCCGTTGAAGGGAAATCCAAGGAGGAAGCTATGGCCGATTACATCACCAAGGTGAAGCAGCTGCTGGAGGAGGCTTCTGCATCCACTTCTTAGGCTATTATGAACAACACCATCAATAGTGCTGCATATATGTACCAATAAACATAAATACTATACCATCATCAGGCGCTTTGTGATCATCCCTTCTCTGTACTTGTAATAGTTTCAAGCAGACTCGGTCCTGTTAATTGATCATGACTGTTATTAAGTTTGTCCGTCTTTTCTAAA
CDS Sequence
  • >LOC_Os06g02490.1
    ATGGGTTTGCAGGAGGAGTTTGAGGAGTTCGCCGAGAAGGCCAAGACCTTGCCTGACACAATTTCCAACGAGGACAAGCTGCTTCTCTATGGCCTCTACAAGCAGGCAACCGTTGGCCCGGTTACCACTGGGCGCCCAGGTATTTTCAACCTGAAAGACAGATACAAATGGGATGCTTGGAAGGCCGTTGAAGGGAAATCCAAGGAGGAAGCTATGGCCGATTACATCACCAAGGTGAAGCAGCTGCTGGAGGAGGCTTCTGCATCCACTTCTTAG
Protein Sequence
  • >LOC_Os06g02490.1
    MGLQEEFEEFAEKAKTLPDTISNEDKLLLYGLYKQATVGPVTTGRPGIFNLKDRYKWDAWKAVEGKSKEEAMADYITKVKQLLEEASASTS*