Information report for OsHDT1;HDT701
Gene Details
|
|
Functional Descriptions
- These data demonstrate that nonadditive gene expression was involved in flowering time control in the hybrid rice and that OsHDT1 level was important for nonadditive or differential expression of many genes including the flowering time genes, suggesting that OsHDT1 may be involved in epigenetic control of parental genome interaction for differential gene expression.
- By contrast, silencing of HDT701 in transgenic rice causes elevated levels of histone H4 acetylation and elevated transcription of pattern recognition receptor (PRR) and defense-related genes, increased generation of reactive oxygen species after pathogen-associated molecular pattern elicitor treatment, as well as enhanced resistance to both M.
- We also found that HDT701 can bind to defense-related genes to regulate their expression.
- Taken together, these results demonstrate that HDT701 negatively regulates innate immunity by modulating the levels of histone H4 acetylation of PRR and defense-related genes in rice.
- HDT701, a histone H4 deacetylase, negatively regulates plant innate immunity by modulating histone H4 acetylation of defense-related genes in rice.
- Increased OsHDT1 expression did not affect plant growth in the parent but led to early flowering in the hybrid.
- Over-expression of OsHDT1 repressed the nonadditive expression of the key flowering repressors in the hybrid (i.
- Transcription of HDT701 is increased in the compatible reaction and decreased in the incompatible reaction after infection by the fungal pathogen Magnaporthe oryzae.
- Overexpression of HDT701 in rice decreases ABA, salt and osmotic stress resistance during seed germination.
- Delayed seed germination of HDT701 overexpression lines is associated with decreased histone H4 acetylation and down-regulated expression of GA biosynthetic genes.
- Taken together, our findings suggested that HDT701 may play an important role in regulating seed germination in response to abiotic stresses in rice.
- Moreover, overexpression of HDT701 in rice enhances salt and osmotic stress resistance during the seedling stage.
- HDT701 is localized at the subcellular level in the nucleus.
- Expression levels of florigens Heading date 3a (Hd3a) and Rice Flowering Locus<U+00A0>T1 (RFT1), and their immediate upstream floral activator Early<U+00A0>heading date 1 (Ehd1), were significantly decreased in the<U+00A0>HDT701 mutants, indicating that HDT701 functions upstream of Ehd1 in controlling flowering time.
Functional Keywords
- flowering-time , defense , growth , flower , magnaporthe-oryzae , seed , seedling , abiotic-stress , salt , seed-germination , stress , ga , GA-biosynthetic , GA , nucleus , biotic-stress , resistance , floral , heading-date
Literature and News
- Altered levels of histone deacetylase OsHDT1 affect differential gene expression patterns in hybrid rice . DOI: 10.1371/journal.pone.0021789 ; PMID: 21760907
- HDT701, a histone H4 deacetylase, negatively regulates plant innate immunity by modulating histone H4 acetylation of defense-related genes in rice . DOI: 10.1105/tpc.112.101972 ; PMID: 22968716
- Expression and functional analysis of the plant-specific histone deacetylase HDT701 in rice . DOI: 10.3389/fpls.2014.00764 ; PMID: 25653654
- Histone Deacetylase 701 (HDT701) Induces Flowering in Rice by Modulating Expression of OsIDS1 . DOI: 10.14348/molcells.2018.0148 ; PMID: 29991671
- Transcriptional and post-transcriptional regulation of heading date in rice . DOI: 10.1111/nph.17158 ; PMID: 33341945
Gene Resources
- UniProt: Q0DFD6
- EMBL: AK072845, AP014961
- AlphaFoldDB: Q0DFD6
- EnsemblPlants: Os05t0597100-01
- Gramene: Os05t0597100-01
- Orthologous matrix: GKNEVHI
- InterPro: IPR013087, IPR041232
- PROSITE: PS00028, PS50157
- Gene3D: 2.60.120.340
- OrthoDB: Q0DFD6
- SWISS-MODEL: Q0DFD6
- eggNOG: ENOG502QVH6
Sequences
cDNA Sequence
- >LOC_Os05g51830.1
AATCCCCTCACAGCCTTAAACCCTAGCTCCGCCTCCCACCTCCCTTTTCTTTTCTAGGGTTCTTCCGCCGCCGCCGCCGCCGCCGCCGATTCCGATGGAGTTCTGGGGTCTTGAAGTCAAGCCTGGACAGACTGTCAAATGTGAGCCTGAAGATGAACGCTTTTTGCACCTTTCTCAGGCTGCTCTTGGGGAATCAAAGAAAGGATCTGACAATGCAGTAATGTATGTTAAAACTGATGATCAAAAGCTAGTCATTGGAACCCTCTCAGCTGACAAGTTCCCTCAAATCCAGTTTGATTTGGTCTTTGACAAAGAGTTTGAGCTGTCACACACTTCAAAGACTGCTAGTGTGTTCTTTTCTGGCTACAAAGTTTCCCAGCCGGCTGAGGAAGATGAAATGGATTTTGATTCTGAAGAAGTTGAAGATGAAGAGGAGGAAGAAAAGATCATTCCAGCTCCCAGGGCAAATGGCAAAGTTGAAGGGAAGGAAAATGAGCAGAAAAAACAAGGCAAGACAGATTCTTCAGCTTCAAAATCAAAGGCTGCAGTGAATGACGATGATGATGATGATGACAGTGATGAGGATGATTCTGAGGACGAAGATCTTTCTCCTGAGGATGATGATGATGATTCTTCTGAGGATGATTCCAGCGAAGATGATGAGGATGAGAGTGACGAGGAAGATACTCCCAAGAAGCCAGAGACTGGAAAGAGGAAAGTAGCTGAAATTGTGTTGAAGACACCTTCGTCTGATAAGAAAGCAAAGATTGCTACACCGTCAGGCCAGAAGACAGGTGACAAGAAGGGTGTCCATGTAGCAACTCCACATCCGGCAAAGCAGGCTAGCAAGACCCCCGTGAATGACAAGTCAAAGGAGAAGTCCCCAAAATCCGGTGGTGGGTCAATTTCTTGCAAGTCATGCAGCAAGACGTTCAACAGTGAAATGGCTCTGCAATCTCACTCGAAGGCCAAGCACCCCGCCAAGTGAAGAATGAGACAACGGATGCTGAGCTGAGAAATATTGGTGTCGTTTGAGTTGGTTATCTGAAATGAAATGAAATGCTGCAAACTATTTGGTGTTATGAGTAGTGTCGTGACGGTTTATGTGGTGCAAACTATTTAGTCTAGAAAAAAAAAATCTGTGGTGCGAACTGAGCTACAATTTTATTCGGTCAAGGTCAGTGGAGTGATTGGTTTATTTTGGATGGAATTATTGTTCTTCCCTGTTATTCGGTTAATTCCCACGAGAAAGGATTGATAACACCACACTGAATTGACTAGCTGAACAAAGTCGTAATATCTGGTTTTGCCCTCGGCCAAATCCGAATATTAGGGTGTGTTTAGTTCGTGTTTTTTGGGTGTTACATTGGATGTTGACCTTAGAAAGGATTTTTTTGATACGAATGAAAAAAATTAATTTCTAACTTGCTTGGAAACCGTGAGACGAA
CDS Sequence
- >LOC_Os05g51830.1
ATGGAGTTCTGGGGTCTTGAAGTCAAGCCTGGACAGACTGTCAAATGTGAGCCTGAAGATGAACGCTTTTTGCACCTTTCTCAGGCTGCTCTTGGGGAATCAAAGAAAGGATCTGACAATGCAGTAATGTATGTTAAAACTGATGATCAAAAGCTAGTCATTGGAACCCTCTCAGCTGACAAGTTCCCTCAAATCCAGTTTGATTTGGTCTTTGACAAAGAGTTTGAGCTGTCACACACTTCAAAGACTGCTAGTGTGTTCTTTTCTGGCTACAAAGTTTCCCAGCCGGCTGAGGAAGATGAAATGGATTTTGATTCTGAAGAAGTTGAAGATGAAGAGGAGGAAGAAAAGATCATTCCAGCTCCCAGGGCAAATGGCAAAGTTGAAGGGAAGGAAAATGAGCAGAAAAAACAAGGCAAGACAGATTCTTCAGCTTCAAAATCAAAGGCTGCAGTGAATGACGATGATGATGATGATGACAGTGATGAGGATGATTCTGAGGACGAAGATCTTTCTCCTGAGGATGATGATGATGATTCTTCTGAGGATGATTCCAGCGAAGATGATGAGGATGAGAGTGACGAGGAAGATACTCCCAAGAAGCCAGAGACTGGAAAGAGGAAAGTAGCTGAAATTGTGTTGAAGACACCTTCGTCTGATAAGAAAGCAAAGATTGCTACACCGTCAGGCCAGAAGACAGGTGACAAGAAGGGTGTCCATGTAGCAACTCCACATCCGGCAAAGCAGGCTAGCAAGACCCCCGTGAATGACAAGTCAAAGGAGAAGTCCCCAAAATCCGGTGGTGGGTCAATTTCTTGCAAGTCATGCAGCAAGACGTTCAACAGTGAAATGGCTCTGCAATCTCACTCGAAGGCCAAGCACCCCGCCAAGTGA
Protein Sequence
- >LOC_Os05g51830.1
MEFWGLEVKPGQTVKCEPEDERFLHLSQAALGESKKGSDNAVMYVKTDDQKLVIGTLSADKFPQIQFDLVFDKEFELSHTSKTASVFFSGYKVSQPAEEDEMDFDSEEVEDEEEEEKIIPAPRANGKVEGKENEQKKQGKTDSSASKSKAAVNDDDDDDDSDEDDSEDEDLSPEDDDDDSSEDDSSEDDEDESDEEDTPKKPETGKRKVAEIVLKTPSSDKKAKIATPSGQKTGDKKGVHVATPHPAKQASKTPVNDKSKEKSPKSGGGSISCKSCSKTFNSEMALQSHSKAKHPAK*