Gene Details:
- MSU gene ID: LOC_Os05g37060
- RAPdb gene ID: Os05g0442400
- Gene Symbol: MID1 OsARM1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- MID1 was primarily expressed in root and leaf vascular tissues, with low level in the tapetum, and was induced by drought and other abiotic stresses.
- Our findings suggest that MID1 is a transcriptional regulator that promotes rice male development under drought by modulating the expressions of drought-related and anther developmental genes and provide valuable information for crop improvement.
- MID1 Plays an Important Role in Response to Drought Stress during Reproductive Development.
- We show here that MID1 (MYB Important for Drought Response1), encoding a putative R-R-type MYB-like transcription factor, can improve rice yield under drought.
- MID1 was localized to the nucleus and could activate gene expression in yeast, and its homologs were identified in many other plants with high levels sequence similarity.
- Here, we show that the rice R2R3 MYB transcription factor OsARM1 (ARSENITE-RESPONSIVE MYB1) regulates As-associated transporters genes.
- Our findings suggest that the OsARM1 transcription factor has essential functions in regulating As uptake and root-to-shoot translocation in rice.
- Histochemical analysis of OsARM1pro::GUS lines indicated that OsARM1 was expressed in the phloem of vascular bundles in basal and upper nodes.
- Knockout of OsARM1 (OsARM1-KO CRISPR/Cas9-generated mutants) improved tolerance to As(III) and overexpression of OsARM1 (OsARM1-OE lines) increased sensitivity to As(III).
- Treatment with As(III) induced OsARM1 transcript accumulation and an OsARM1-GFP fusion localized to the nucleus.
- In particular, the As(III) levels in node I were significantly higher in OsARM1-KOs, but significantly lower in OsARM1-OEs, compared to wild-type plants, implying that OsARM1 is important for the regulation of root-to-shoot translocation of As.
Function-related keywords:
- leaf , root , anther , development , drought , transcription-factor , yield , abiotic-stress , reproductive , stress , nucleus , anther-development , biotic-stress , drought-stress , transcriptional-regulator , reproductive-development , vascular-bundle , tolerance , phloem , node
Literature:
- MID1 plays an important role in response to drought stress during reproductive development . DOI: 10.1111/tpj.13250 ; PMID: 27337541
- OsARM1, an R2R3 MYB Transcription Factor, Is Involved in Regulation of the Response to Arsenic Stress in Rice . DOI: 10.3389/fpls.2017.01868 ; PMID: 29163593
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os05g37060.1
AGATCCAAGGCTATCTAAGCACCGGCATTTGCATACAGCCGCCTAAGCAAAGAGCACAGCAAGTATACGCGAATCTGAGTGTGTGAGAGAGACTAGTAGCACAGACGAAGGTATGGCGTTCTACCTCGGCAGCATGGGTGGCTCGCCATCGTCATGGGGGGTGGCGGAGGTGCCGGTGCCGAGCAGCAGGCCGTGGAGCAAGGCGGAGGACAAGGTGTTCGAGAGCGCGCTCGTGGCGTTCCCGGAGCACACGCACAACCGGTGGGCGCTCGTCGCGTCGCGGCTCCCGGGGCGCTCGGCGCACGAGGTTTGGGAACACTACCAGGTGCTCGTGGACGATGTCGACCTCATCGAGCGTGGCATGGTTGCGTCCCCGGGCTGCTGGGACGACGACAACAACAGCGCCGGCCACGGCCGTGGCAGTGGTGGGGATGAGCGTCGTCGCGGCGTGCCCTGGACTGAGGAGGAGCACAGGCTATTTCTTGAAGGGCTAGAGAAATATGGGCGTGGCGACTGGCGCAACATCTCGCGCTGGTCGGTGAAGACGCGGACTCCGACGCAAGTGGCGAGCCATGCGCAGAAGTTCTTCATCCGACAGGCCAACGCCAGCAGCCGTGGCGACTCCAAGCGTAAGAGCATCCACGACATCACTGCCCCATGATGTGTGGTCCGATCGAGGATATGCATTATGATCCGGTCCAGTCTAGGTTTAGTTGTATTTCCATCAATTCCAACTAGCTTTCAACCCCATTTCAAAGAGGAGAGAACGAAGGGAGTTTAGTCGTCGGCCCTCCCTGTTAGTTCCTCTCTCTGTGTTGTGTAAAATATAGCTAGGCAATAGCTAAAACTAAGCTTGGCTGGAACCTGAGATCAATTGTTGTGATACTAGTTTGTGTACTTGTCAAATAATATTTGTATCCGTTTAATTTCA
CDS Sequence
- >LOC_Os05g37060.1
ATGGCGTTCTACCTCGGCAGCATGGGTGGCTCGCCATCGTCATGGGGGGTGGCGGAGGTGCCGGTGCCGAGCAGCAGGCCGTGGAGCAAGGCGGAGGACAAGGTGTTCGAGAGCGCGCTCGTGGCGTTCCCGGAGCACACGCACAACCGGTGGGCGCTCGTCGCGTCGCGGCTCCCGGGGCGCTCGGCGCACGAGGTTTGGGAACACTACCAGGTGCTCGTGGACGATGTCGACCTCATCGAGCGTGGCATGGTTGCGTCCCCGGGCTGCTGGGACGACGACAACAACAGCGCCGGCCACGGCCGTGGCAGTGGTGGGGATGAGCGTCGTCGCGGCGTGCCCTGGACTGAGGAGGAGCACAGGCTATTTCTTGAAGGGCTAGAGAAATATGGGCGTGGCGACTGGCGCAACATCTCGCGCTGGTCGGTGAAGACGCGGACTCCGACGCAAGTGGCGAGCCATGCGCAGAAGTTCTTCATCCGACAGGCCAACGCCAGCAGCCGTGGCGACTCCAAGCGTAAGAGCATCCACGACATCACTGCCCCATGA
Protein Sequence
- >LOC_Os05g37060.1
MAFYLGSMGGSPSSWGVAEVPVPSSRPWSKAEDKVFESALVAFPEHTHNRWALVASRLPGRSAHEVWEHYQVLVDDVDLIERGMVASPGCWDDDNNSAGHGRGSGGDERRRGVPWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKFFIRQANASSRGDSKRKSIHDITAP*