Gene Details:

Functional Descriptions:

  • A 3-bp deletion of WLS5 gene leads to weak growth and early leaf senescence in rice.
  • Knockout of LOC_Os05g04900 in Nipponbare plants caused leaf senescence, confirming this locus as the causal gene for WLS5.
  • Further molecular study of WLS5 will uncover the roles of this gene in plant growth and leaf senescence.
  • Histological analysis showed that the poor growth of WLS5 plants involved a reduction in cell length and number.
  • The WLS5 mutants also exhibited significantly higher stomatal density and altered phytohormone contents compared with wild-type plants.
  • Physiological analysis and transmission electron microscopy revealed that the WLS5 cells had abnormal chloroplasts, and the mutants underwent chlorophyll degradation triggered by accumulation of reactive oxygen species.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Sequences:

cDNA Sequence
  • >LOC_Os05g04900.1
    ATGGATTCATCTGCTGCGGATGGTGAGACGAAGGAGGAGTCGTCGAAAGTGAAGATGTTGCTGCCGGAAGATTTCCTCAACACCGTCCTCCTCTGCACTGCTTTCTTGTACAAGGCGATGAATACCATCGGCACGCTGGCCACCATCTGGGCGACCGTCGTCCTGCTCGGTGGATTCTCCACCCTCATCAAGAAGGAGGACTTTTGGTACGTCACCGTCATCGCCTTCGTCCAATCCATCGGAATACTGGTTAAGCAGTAA
CDS Sequence
  • >LOC_Os05g04900.1
    ATGGATTCATCTGCTGCGGATGGTGAGACGAAGGAGGAGTCGTCGAAAGTGAAGATGTTGCTGCCGGAAGATTTCCTCAACACCGTCCTCCTCTGCACTGCTTTCTTGTACAAGGCGATGAATACCATCGGCACGCTGGCCACCATCTGGGCGACCGTCGTCCTGCTCGGTGGATTCTCCACCCTCATCAAGAAGGAGGACTTTTGGTACGTCACCGTCATCGCCTTCGTCCAATCCATCGGAATACTGGTTAAGCAGTAA
Protein Sequence
  • >LOC_Os05g04900.1
    MDSSAADGETKEESSKVKMLLPEDFLNTVLLCTAFLYKAMNTIGTLATIWATVVLLGGFSTLIKKEDFWYVTVIAFVQSIGILVKQ*