Information report for MOC3;OsWUS
Gene Details
|
|
Functional Descriptions
- Morphological observation revealed that the formation of tiller buds was disrupted in MOC3.
- The expression of MOC3 was induced by cytokinins and defection of MOC3 affected the expression of several two-component cytokinin response regulators, OsRRs and ORRs.
- Homeobox Is Pivotal for OsWUS Controlling Tiller Development and Female Fertility in Rice.
- OsWUS has recently been shown to be a transcription factor gene critical for tiller development and fertility in rice.
- Map-based cloning revealed that the mutant phenotypes were caused by a mutation in OsWUS Compared with the two previously reported null allelic mutants of OsWUS (tab1-1 and moc3-1), which could produce partial N-terminal peptides of OsWUS, the srt1 protein contained a deletion of only seven amino acids within the conserved homeobox domain of OsWUS.
- Recently, we showed that a double mutant of FLORAL ORGAN NUMBER2 (FON2) and ABERRANT SPIKELET AND PANICLE1 (ASP1) led to a marked enlargement of the inflorescence meristem, and that the TAB1 function is not associated with massive stem cells in this meristem.
- In addition, misexpression of TAB1 under the promoter of FON1 led to a slight reduction of the SAM size in wild type, suggesting that TAB1 is not a positive regulator of stem cells.
- In this paper, we confirmed that TAB1 is also unrelated to the enlargement of the SAM in the vegetative phase of the fon2 and fon2 asp1 mutants.
- Taking together, TAB1 seems not to be involved in meristem maintenance, irrespective of the meristem type.
- We revealed that stem cells were established at an early stage of axillary meristem development in wild type, but were not maintained in TAB1.
- By contrast, the stem cell region and TAB1 expression domain were expanded in fon2, and FON2 overexpression inhibited axillary meristem formation.
- These results indicate that TAB1 is required to maintain stem cells during axillary meristem development, whereas FON2 negatively regulates stem cell fate by restricting TAB1 expression.
- OsWUS promotes tiller bud growth by establishing weak apical dominance in rice.
- Auxin response is enhanced in the dc1 mutant, and knocking out the auxin action-associated gene ABERRANT SPIKELET AND PANICLE 1 (ASP1) de-repressed growth of the tiller buds in the dc1 mutant, suggesting that OsWUS and ASP1 are both involved in outgrowth of the rice tiller bud.
- Collectively, these findings reveal an important role of OsWUS in tiller bud growth by influencing apical dominance, and provide the basis for an improved understanding of tiller bud development in rice.
- In this study, we identified and functionally characterized a low-tillering mutant decreased culm number 1 (dc1) that resulted from loss-of-function of OsWUS.
- Our results suggest that OsWUS is a precise regulatory element, its specific spatio-temporal expression pattern is critical for its function, and both loss-of-function and gain-of-function mutations lead to abnormal plant growth.
- Changes in the expression pattern of OsWUS negatively regulate plant stature and panicle development in rice.
- OsWUS have distinct functions in meristem development with slightly tuned expression.
Functional Keywords
- tiller , cytokinin , cytokinin-response , development , map-based-cloning , transcription-factor , fertility , stem , spikelet , vegetative , floral , meristem , inflorescence , floral-organ , floral-organ-number , axillary-meristem , growth , auxin , panicle , culm , auxin-response , plant-growth , panicle-development , plant-stature
Literature and News
- MONOCULM 3, an ortholog of WUSCHEL in rice, is required for tiller bud formation . DOI: 10.1016/j.jgg.2014.12.005 ; PMID: 25697101
- Axillary Meristem Formation in Rice Requires the WUSCHEL Ortholog TILLERS ABSENT1 . DOI: 10.1105/tpc.15.00074 ; PMID: 25841039
- Homeobox Is Pivotal for OsWUS Controlling Tiller Development and Female Fertility in Rice . DOI: 10.1534/g3.116.028837 ; PMID: 27194802
- TILLERS ABSENT1, the WUSCHEL ortholog, is not involved in stem cell maintenance in the shoot apical meristem in rice . DOI: 10.1080/15592324.2019.1640565 ; PMID: 31284830
- Antagonistic action of TILLERS ABSENT1 and FLORAL ORGAN NUMBER2 regulates stem cell maintenance during axillary meristem development in rice . DOI: 10.1111/nph.16163 ; PMID: 31486529
- OsWUS promotes tiller bud growth by establishing weak apical dominance in rice . DOI: 10.1111/tpj.15026 ; PMID: 33064890
- Changes in the expression pattern of OsWUS negatively regulate plant stature and panicle development in rice . DOI: 10.1093/g3journal/jkad100 ; PMID: 37141284
Gene Resources
- UniProt: Q7XM13
- EMBL: AB218894, AL606999, AM234746
- AlphaFoldDB: Q7XM13
- EnsemblPlants: Os04t0663600-01
- Gramene: Os04t0663600-01
- KEGG: osa:107275471
- Orthologous matrix: RELYYSC
- InterPro: IPR001356, IPR009057, IPR044555
- PANTHER: PTHR45940, PTHR45940:SF2
- SUPFAM: SSF46689
- PROSITE: PS50071
- Gene3D: 1.10.10.60
- OrthoDB: Q7XM13
- SWISS-MODEL: Q7XM13
- Conserved Domain Database: cd00086
- eggNOG: ENOG502QRYV
Sequences
cDNA Sequence
- >LOC_Os04g56780.1
ATGGATCACATGCAGCAGCAGCAGCGGCAGCAGGTGGGTGGAGGGGGAGGAGAGGAGGTGGCGGGGAGGGGTGGTGTGCCGGTGTGCCGGCCGAGCGGGACGAGGTGGACGCCGACGACGGAGCAGATCAAGATCCTGCGGGAGCTGTACTACAGCTGCGGCATCAGGTCGCCCAACTCGGAGCAGATCCAGCGGATCGCCGCCATGCTGCGCCAGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGAGCGCCAGAAGAAGCGCCTCACCACGCTCGACGTCACCACCACCACCGCCGCCGCCGCCGACGCCGACGCCAGCCACCTCGCCGTCCTCTCCCTCTCGCCTACAGCAGCTGGCGCGACGGCTCCCTCTTTCCCGGGCTTCTACGTCGGCAATGGCGGCGCCGTGCAGACGGATCAGGCCAACGTCGTCAACTGGGACTGCACCGCCATGGCAGCCGAGAAAACCTTCCTGCAGGACTACATGGGCGTGAGCGGCGTCGGTTGCGCCGCCGGGGCGGCCCCGACGCCGTGGGCGATGACGACGACGACTCGCGAGCCCGAGACGCTTCCACTCTTCCCAGTCGTCTTCGTCGGCGGCGACGGCGCGCATCGTCACGCCGTCCACGGCGGTTTCCCGTCCAACTTCCAGCGCTGGGGTTCTGCTGCTGCTACCTCCAACACCATTACGGTCCAGCAGCATTTGCAGCAGCACAACTTTTACAGCAGCAGCAGCAGCCAGCTGCACAGCCAGGATGGGCCGGCAGCAGGCACATCCCTGGAGCTCACTCTCAGCTCCTACTACTGCTCATGCTCACCTTACCCTGCAGGGTCCATGTGA
CDS Sequence
- >LOC_Os04g56780.1
ATGGATCACATGCAGCAGCAGCAGCGGCAGCAGGTGGGTGGAGGGGGAGGAGAGGAGGTGGCGGGGAGGGGTGGTGTGCCGGTGTGCCGGCCGAGCGGGACGAGGTGGACGCCGACGACGGAGCAGATCAAGATCCTGCGGGAGCTGTACTACAGCTGCGGCATCAGGTCGCCCAACTCGGAGCAGATCCAGCGGATCGCCGCCATGCTGCGCCAGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGAGCGCCAGAAGAAGCGCCTCACCACGCTCGACGTCACCACCACCACCGCCGCCGCCGCCGACGCCGACGCCAGCCACCTCGCCGTCCTCTCCCTCTCGCCTACAGCAGCTGGCGCGACGGCTCCCTCTTTCCCGGGCTTCTACGTCGGCAATGGCGGCGCCGTGCAGACGGATCAGGCCAACGTCGTCAACTGGGACTGCACCGCCATGGCAGCCGAGAAAACCTTCCTGCAGGACTACATGGGCGTGAGCGGCGTCGGTTGCGCCGCCGGGGCGGCCCCGACGCCGTGGGCGATGACGACGACGACTCGCGAGCCCGAGACGCTTCCACTCTTCCCAGTCGTCTTCGTCGGCGGCGACGGCGCGCATCGTCACGCCGTCCACGGCGGTTTCCCGTCCAACTTCCAGCGCTGGGGTTCTGCTGCTGCTACCTCCAACACCATTACGGTCCAGCAGCATTTGCAGCAGCACAACTTTTACAGCAGCAGCAGCAGCCAGCTGCACAGCCAGGATGGGCCGGCAGCAGGCACATCCCTGGAGCTCACTCTCAGCTCCTACTACTGCTCATGCTCACCTTACCCTGCAGGGTCCATGTGA
Protein Sequence
- >LOC_Os04g56780.1
MDHMQQQQRQQVGGGGGEEVAGRGGVPVCRPSGTRWTPTTEQIKILRELYYSCGIRSPNSEQIQRIAAMLRQYGRIEGKNVFYWFQNHKARERQKKRLTTLDVTTTTAAAADADASHLAVLSLSPTAAGATAPSFPGFYVGNGGAVQTDQANVVNWDCTAMAAEKTFLQDYMGVSGVGCAAGAAPTPWAMTTTTREPETLPLFPVVFVGGDGAHRHAVHGGFPSNFQRWGSAAATSNTITVQQHLQQHNFYSSSSSQLHSQDGPAAGTSLELTLSSYYCSCSPYPAGSM*