Gene Details:

Functional Descriptions:

  • Overexpression of OsAP2-39 leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines.
  • Transcriptional activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene synthesis and drought tolerance in rice.
  • Together, these results reveal a novel mechanism for the control of the ABA/GA balance in rice which is regulated by OsAP2-39 that in turn regulates plant growth and seed production.
  • Moreover, overexpression of OsERF3/OsAP2-39 suppressed ethylene synthesis.
  • The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice.
  • Global transcriptome analysis of the OsAP2-39 overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level.
  • The exogenous application of GA restores the wild-type phenotype in the transgenic line and ABA application induces the expression of EUI and suppresses the expression of OsAP2-39 in the wild-type line.
  • Emerging evidence indicates that two APETALA 2 (AP2)-domain-containing transcription factors (ATFs), ABI4 in Arabidopsis and OsAP2-39 in rice, play key roles in ABA and GA antagonism.
  • The double mutant for the DEP1 and AP2-like genes (OsAP2-39) showed decreased endogenous abscisic acid (ABA) level and insensitivity to exogenous ABA treatment, confirming that both DEP1 and OsAP2-39 are involved in the ABA response mechanism.
  • In summary, our study suggests that OsDREB2B plays a negative role in rice growth and development by regulating GA metabolic gene expression, which is mediated by OsAP2-39 and OsWRKY21, thereby reducing GA content and rice plant height.
  • OsDREB2B localized to the nucleus of the rice protoplast acted as a transcription activator and upregulated OsAP2-39 by directly binding to its promoter.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Sequences:

cDNA Sequence
  • >LOC_Os04g52090.1
    CTCCAACGCACCACCGGCGCCAAACCAACCACCCACCATCCACCGGTCGAACACTTGGCGCTCTCGCCCGCCTTAGCTCGCTCTGCTCGTGGTGCTCGACCCGAACAAGAACGGACATGGCTCCCAGGAACGCCGCCGAGGCCGTCGCCGTCGCCGTGGCGGAGGGCGGAGGAGCCGGCATGGAGCCCAGGTTCCGCGGCGTGAGGAAGCGCCCGTGGGGCAGGTACGCGGCGGAGATCCGCGACCCGGCCAGGAAGGCGCGGGTGTGGCTCGGCACCTTCGACACCGCCGAGGCCGCGGCGCGCGCCTACGACAGCGCCGCGCTCCACTTCCGCGGGCCCAAGGCCAAGACCAACTTCCCCGTCGCCTTCGCGCACGCCCACCACCACGCCCCGCCGCCGCCGCTGCCCAAGGCGGCGGCGCTGGCCGTCGTCAGCCCGACCAGCAGCACGGTCGAGTCGTCCTCCCGGGACACGCCCGCCGCCGCCCCGGTGGCGGCCGCGGCCAAGGCCCAGGTGCCCGCCTCGCCTTCGCTCGATCTGAGCCTCGGGATGTCGGCCATGGTGGCCGCCCAGCCGTTCCTGTTCCTCGACCCCAGGGTCGCGGTGACCGTGGCCGTCGCGGCACCGGTGCCTCGCCGGCCGGCCGTCGTCAGCGTCAAGAAGGAGGTAGCTCGCCTGGACGAGCAGAGCGACACCGGCTCGTCGTCATCCGTGGTGGACGCCTCGCCGGCCGTCGGCGTGGGGCTCGACCTGAACCTGCCGCCGCCGATCGAGGAGGCGTAGGTTGCAGCGCCCGATGACGACGACAAGACCCCCCCACAAATCCCTCGTAGAAAAGTCTAGAGCGACGTGTAATAGTAAGAGGTTAATCGTCCGTTTAATTGCCAGGATTGATCAACTAGGTGTACATAGATCGTGTCCTTTTTGCACGGGGAGATAGGTATGAGGAAAAGGCTACTACTCCCGGTGTTACAGTTCCTTTAAAGAAAGAAGGAAAAAAACAAGAAAAGAAAAAGAAAACATTTTGTTGTTCGATGTAACATATTGATCATCAATCTCTGATTAATGAGAAATTTACGTTATTTTGTTCTTAAAAA
CDS Sequence
  • >LOC_Os04g52090.1
    ATGGCTCCCAGGAACGCCGCCGAGGCCGTCGCCGTCGCCGTGGCGGAGGGCGGAGGAGCCGGCATGGAGCCCAGGTTCCGCGGCGTGAGGAAGCGCCCGTGGGGCAGGTACGCGGCGGAGATCCGCGACCCGGCCAGGAAGGCGCGGGTGTGGCTCGGCACCTTCGACACCGCCGAGGCCGCGGCGCGCGCCTACGACAGCGCCGCGCTCCACTTCCGCGGGCCCAAGGCCAAGACCAACTTCCCCGTCGCCTTCGCGCACGCCCACCACCACGCCCCGCCGCCGCCGCTGCCCAAGGCGGCGGCGCTGGCCGTCGTCAGCCCGACCAGCAGCACGGTCGAGTCGTCCTCCCGGGACACGCCCGCCGCCGCCCCGGTGGCGGCCGCGGCCAAGGCCCAGGTGCCCGCCTCGCCTTCGCTCGATCTGAGCCTCGGGATGTCGGCCATGGTGGCCGCCCAGCCGTTCCTGTTCCTCGACCCCAGGGTCGCGGTGACCGTGGCCGTCGCGGCACCGGTGCCTCGCCGGCCGGCCGTCGTCAGCGTCAAGAAGGAGGTAGCTCGCCTGGACGAGCAGAGCGACACCGGCTCGTCGTCATCCGTGGTGGACGCCTCGCCGGCCGTCGGCGTGGGGCTCGACCTGAACCTGCCGCCGCCGATCGAGGAGGCGTAG
Protein Sequence
  • >LOC_Os04g52090.1
    MAPRNAAEAVAVAVAEGGGAGMEPRFRGVRKRPWGRYAAEIRDPARKARVWLGTFDTAEAAARAYDSAALHFRGPKAKTNFPVAFAHAHHHAPPPPLPKAAALAVVSPTSSTVESSSRDTPAAAPVAAAAKAQVPASPSLDLSLGMSAMVAAQPFLFLDPRVAVTVAVAAPVPRRPAVVSVKKEVARLDEQSDTGSSSSVVDASPAVGVGLDLNLPPPIEEA*