Information report for OsAP2-39
Gene Details
|
|
Functional Descriptions
- Overexpression of OsAP2-39 leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines.
- Transcriptional activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene synthesis and drought tolerance in rice.
- Together, these results reveal a novel mechanism for the control of the ABA/GA balance in rice which is regulated by OsAP2-39 that in turn regulates plant growth and seed production.
- Moreover, overexpression of OsERF3/OsAP2-39 suppressed ethylene synthesis.
- The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice.
- Global transcriptome analysis of the OsAP2-39 overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level.
- The exogenous application of GA restores the wild-type phenotype in the transgenic line and ABA application induces the expression of EUI and suppresses the expression of OsAP2-39 in the wild-type line.
- Emerging evidence indicates that two APETALA 2 (AP2)-domain-containing transcription factors (ATFs), ABI4 in Arabidopsis and OsAP2-39 in rice, play key roles in ABA and GA antagonism.
- The double mutant for the DEP1 and AP2-like genes (OsAP2-39) showed decreased endogenous abscisic acid (ABA) level and insensitivity to exogenous ABA treatment, confirming that both DEP1 and OsAP2-39 are involved in the ABA response mechanism.
- In summary, our study suggests that OsDREB2B plays a negative role in rice growth and development by regulating GA metabolic gene expression, which is mediated by OsAP2-39 and OsWRKY21, thereby reducing GA content and rice plant height.
- OsDREB2B localized to the nucleus of the rice protoplast acted as a transcription activator and upregulated OsAP2-39 by directly binding to its promoter.
Functional Keywords
- biomass , drought , seed , ethylene , transcription-factor , yield , ABA , ga , growth , drought-tolerance , gibberellin , GA , abscisic-acid , development , nucleus , height , plant-height , transcription-activator
Literature and News
- Transcriptional activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene synthesis and drought tolerance in rice . DOI: 10.1371/journal.pone.0025216 ; PMID: 21966459
- The APETALA-2-like transcription factor OsAP2-39 controls key interactions between abscisic acid and gibberellin in rice . DOI: 10.1371/journal.pgen.1001098 ; PMID: 20838584
- APETALA 2-domain-containing transcription factors: focusing on abscisic acid and gibberellins antagonism . DOI: 10.1111/nph.14880 ; PMID: 29058311
- Multiple areas investigation reveals the genes related to vascular bundles in rice . DOI: 10.1186/s12284-019-0278-x ; PMID: 30900100
- OsDREB2B, an AP2/ERF transcription factor, negatively regulates plant height by conferring GA metabolism in rice . DOI: 10.3389/fpls.2022.1007811 ; PMID: 36388558
Gene Resources
- UniProt: Q7XPL6
- EMBL: AP014960
- AlphaFoldDB: Q7XPL6
- EnsemblPlants: Os04t0610400-01
- Gramene: Os04t0610400-01
- KEGG: osa:4336947
- Orthologous matrix: PGCARRY
- InterPro: IPR001471, IPR016177, IPR036955
- PANTHER: PTHR31677, PTHR31677:SF241
- SUPFAM: SSF54171
- PROSITE: PS51032
- Gene3D: 3.30.730.10
- OrthoDB: Q7XPL6
- SWISS-MODEL: Q7XPL6
- Conserved Domain Database: cd00018
- eggNOG: ENOG502RYHH
Sequences
cDNA Sequence
- >LOC_Os04g52090.1
CTCCAACGCACCACCGGCGCCAAACCAACCACCCACCATCCACCGGTCGAACACTTGGCGCTCTCGCCCGCCTTAGCTCGCTCTGCTCGTGGTGCTCGACCCGAACAAGAACGGACATGGCTCCCAGGAACGCCGCCGAGGCCGTCGCCGTCGCCGTGGCGGAGGGCGGAGGAGCCGGCATGGAGCCCAGGTTCCGCGGCGTGAGGAAGCGCCCGTGGGGCAGGTACGCGGCGGAGATCCGCGACCCGGCCAGGAAGGCGCGGGTGTGGCTCGGCACCTTCGACACCGCCGAGGCCGCGGCGCGCGCCTACGACAGCGCCGCGCTCCACTTCCGCGGGCCCAAGGCCAAGACCAACTTCCCCGTCGCCTTCGCGCACGCCCACCACCACGCCCCGCCGCCGCCGCTGCCCAAGGCGGCGGCGCTGGCCGTCGTCAGCCCGACCAGCAGCACGGTCGAGTCGTCCTCCCGGGACACGCCCGCCGCCGCCCCGGTGGCGGCCGCGGCCAAGGCCCAGGTGCCCGCCTCGCCTTCGCTCGATCTGAGCCTCGGGATGTCGGCCATGGTGGCCGCCCAGCCGTTCCTGTTCCTCGACCCCAGGGTCGCGGTGACCGTGGCCGTCGCGGCACCGGTGCCTCGCCGGCCGGCCGTCGTCAGCGTCAAGAAGGAGGTAGCTCGCCTGGACGAGCAGAGCGACACCGGCTCGTCGTCATCCGTGGTGGACGCCTCGCCGGCCGTCGGCGTGGGGCTCGACCTGAACCTGCCGCCGCCGATCGAGGAGGCGTAGGTTGCAGCGCCCGATGACGACGACAAGACCCCCCCACAAATCCCTCGTAGAAAAGTCTAGAGCGACGTGTAATAGTAAGAGGTTAATCGTCCGTTTAATTGCCAGGATTGATCAACTAGGTGTACATAGATCGTGTCCTTTTTGCACGGGGAGATAGGTATGAGGAAAAGGCTACTACTCCCGGTGTTACAGTTCCTTTAAAGAAAGAAGGAAAAAAACAAGAAAAGAAAAAGAAAACATTTTGTTGTTCGATGTAACATATTGATCATCAATCTCTGATTAATGAGAAATTTACGTTATTTTGTTCTTAAAAA
CDS Sequence
- >LOC_Os04g52090.1
ATGGCTCCCAGGAACGCCGCCGAGGCCGTCGCCGTCGCCGTGGCGGAGGGCGGAGGAGCCGGCATGGAGCCCAGGTTCCGCGGCGTGAGGAAGCGCCCGTGGGGCAGGTACGCGGCGGAGATCCGCGACCCGGCCAGGAAGGCGCGGGTGTGGCTCGGCACCTTCGACACCGCCGAGGCCGCGGCGCGCGCCTACGACAGCGCCGCGCTCCACTTCCGCGGGCCCAAGGCCAAGACCAACTTCCCCGTCGCCTTCGCGCACGCCCACCACCACGCCCCGCCGCCGCCGCTGCCCAAGGCGGCGGCGCTGGCCGTCGTCAGCCCGACCAGCAGCACGGTCGAGTCGTCCTCCCGGGACACGCCCGCCGCCGCCCCGGTGGCGGCCGCGGCCAAGGCCCAGGTGCCCGCCTCGCCTTCGCTCGATCTGAGCCTCGGGATGTCGGCCATGGTGGCCGCCCAGCCGTTCCTGTTCCTCGACCCCAGGGTCGCGGTGACCGTGGCCGTCGCGGCACCGGTGCCTCGCCGGCCGGCCGTCGTCAGCGTCAAGAAGGAGGTAGCTCGCCTGGACGAGCAGAGCGACACCGGCTCGTCGTCATCCGTGGTGGACGCCTCGCCGGCCGTCGGCGTGGGGCTCGACCTGAACCTGCCGCCGCCGATCGAGGAGGCGTAG
Protein Sequence
- >LOC_Os04g52090.1
MAPRNAAEAVAVAVAEGGGAGMEPRFRGVRKRPWGRYAAEIRDPARKARVWLGTFDTAEAAARAYDSAALHFRGPKAKTNFPVAFAHAHHHAPPPPLPKAAALAVVSPTSSTVESSSRDTPAAAPVAAAAKAQVPASPSLDLSLGMSAMVAAQPFLFLDPRVAVTVAVAAPVPRRPAVVSVKKEVARLDEQSDTGSSSSVVDASPAVGVGLDLNLPPPIEEA*