Gene Details:

Functional Descriptions:

  • RNA-seq results revealed that 84% of genes upregulated by IRP1 peptide were also induced by a microbe-associated molecular pattern(MAMP) chitin, including 13 OsWRKY transcription factors, indicating that IRP1 and chitin share a similar signaling pathway.
  • Rice plants overexpressing IRP1 enhanced resistance to the virulent rice blast fungus.
  • Application of IRP1 peptide to rice suspension cells triggered the expression of IRP1 itself and the defense gene PAL1.
  • Here, we studied IRP1 functions in rice immunity.
  • Collectively, our findings indicate that IRP1 functions as a phytocyokine in rice immunity regulating MAPKs and OsWRKYs that could amplify chitin and other signaling pathways, and provide new insights into how MAMPs and phytocyokines cooperatively regulate rice immunity.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Sequences:

cDNA Sequence
  • >LOC_Os04g28390.1
    ATATATCAATGGCGATGACAGCAGCGAGGGCGATGGCGATGGCGAGGGCGGTGGTGGCGGTGCTGCTGCTGGTGCAGATCTTGGGCGCCATGGCCGTCTCGGCGAGGACGATGAAGGGGGAAGGGTGGCTGGAGGACGGGATCGGCATGGTGGTCGACATGCTCGGCGAGCTCAAGTCTGGGGGCAACTCTCCCACACACTGCTGCTAACTGAGCAGGGTGTAGTCAGC
CDS Sequence
  • >LOC_Os04g28390.1
    ATGGCGATGACAGCAGCGAGGGCGATGGCGATGGCGAGGGCGGTGGTGGCGGTGCTGCTGCTGGTGCAGATCTTGGGCGCCATGGCCGTCTCGGCGAGGACGATGAAGGGGGAAGGGTGGCTGGAGGACGGGATCGGCATGGTGGTCGACATGCTCGGCGAGCTCAAGTCTGGGGGCAACTCTCCCACACACTGCTGCTAA
Protein Sequence
  • >LOC_Os04g28390.1
    MAMTAARAMAMARAVVAVLLLVQILGAMAVSARTMKGEGWLEDGIGMVVDMLGELKSGGNSPTHCC*