Gene Details:
- MSU gene ID: LOC_Os04g28390
- RAPdb gene ID: Os04g0352066
- Gene Symbol: IRP1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- RNA-seq results revealed that 84% of genes upregulated by IRP1 peptide were also induced by a microbe-associated molecular pattern(MAMP) chitin, including 13 OsWRKY transcription factors, indicating that IRP1 and chitin share a similar signaling pathway.
- Rice plants overexpressing IRP1 enhanced resistance to the virulent rice blast fungus.
- Application of IRP1 peptide to rice suspension cells triggered the expression of IRP1 itself and the defense gene PAL1.
- Here, we studied IRP1 functions in rice immunity.
- Collectively, our findings indicate that IRP1 functions as a phytocyokine in rice immunity regulating MAPKs and OsWRKYs that could amplify chitin and other signaling pathways, and provide new insights into how MAMPs and phytocyokines cooperatively regulate rice immunity.
Function-related keywords:
Literature:
- The secreted immune response peptide 1 functions as a phytocytokine in rice immunity . DOI: 10.1093/jxb/erac455 ; PMID: 36383488
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os04g28390.1
ATATATCAATGGCGATGACAGCAGCGAGGGCGATGGCGATGGCGAGGGCGGTGGTGGCGGTGCTGCTGCTGGTGCAGATCTTGGGCGCCATGGCCGTCTCGGCGAGGACGATGAAGGGGGAAGGGTGGCTGGAGGACGGGATCGGCATGGTGGTCGACATGCTCGGCGAGCTCAAGTCTGGGGGCAACTCTCCCACACACTGCTGCTAACTGAGCAGGGTGTAGTCAGC
CDS Sequence
- >LOC_Os04g28390.1
ATGGCGATGACAGCAGCGAGGGCGATGGCGATGGCGAGGGCGGTGGTGGCGGTGCTGCTGCTGGTGCAGATCTTGGGCGCCATGGCCGTCTCGGCGAGGACGATGAAGGGGGAAGGGTGGCTGGAGGACGGGATCGGCATGGTGGTCGACATGCTCGGCGAGCTCAAGTCTGGGGGCAACTCTCCCACACACTGCTGCTAA
Protein Sequence
- >LOC_Os04g28390.1
MAMTAARAMAMARAVVAVLLLVQILGAMAVSARTMKGEGWLEDGIGMVVDMLGELKSGGNSPTHCC*