Gene Details:

Functional Descriptions:

  • Real-time PCR analysis showed that OsFWL4 expression was induced by CdCl2stress in rice seedlings.
  • 2-like" (OsFWL) affects Cd resistance in yeast, and OsFWL4 mediates the translocation of Cd from roots to shoots.
  • The Cd contents of OsFWL3-, -4-, -6- and -7-transformed Cd(II)-sensitive yeast mutant ycf1 cells were strongly decreased compared with those of empty vector, with the strongest resistance to Cd observed in cells expressing OsFWL4.
  • Evaluation of truncated and site-directed mutation derivatives revealed that the CCXXG motifs near the second transmembrane region of OsFWL4 are involved in Cd resistance in yeast.
  • These results suggest that OsFWL4 might act directly as a transporter and is involved in the translocation of Cd from roots to shoots in rice.
  • The rice "fruit-weight 2.2-like" gene family member OsFWL4 is involved in the translocation of cadmium from roots to shoots.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Sequences:

cDNA Sequence
  • >LOC_Os03g61440.1
    ATGGCGAGGCCGCAACACAATGACTGGTCATCCGGACTCTTCGCCTGCTTCAATGACTGCGAAGTTTGTTGCTTGACGACGGTGTGCCCGTGCATCACGTTCGGGCGGAGCGCGGAGATCGTGTCGAGGGGGGAGAGGACGTGCTGCGCGGCGGGCGTGATGTGCGTGCTGCTCGGCTTCTTCGCCCACTGCCACTGCCTCTACTCCTGCTGCTACCGCGGCAAGATGCGCGACAGCTTCCACCTCCCCGAGGACCCATGCTGCGACTGCTGCGTCCACGCCCTCTGCCTGCAGTGCGCGCTGTGCCAGGAGTACAGGCACCTCAAGAGCCTCGGCTACAAACCCTCGCTTGGCTGGCTCGGAAACAACCAGCACGTCCCGCCCAAGCACAACCCGCCGATGCGACGCTAA
CDS Sequence
  • >LOC_Os03g61440.1
    ATGGCGAGGCCGCAACACAATGACTGGTCATCCGGACTCTTCGCCTGCTTCAATGACTGCGAAGTTTGTTGCTTGACGACGGTGTGCCCGTGCATCACGTTCGGGCGGAGCGCGGAGATCGTGTCGAGGGGGGAGAGGACGTGCTGCGCGGCGGGCGTGATGTGCGTGCTGCTCGGCTTCTTCGCCCACTGCCACTGCCTCTACTCCTGCTGCTACCGCGGCAAGATGCGCGACAGCTTCCACCTCCCCGAGGACCCATGCTGCGACTGCTGCGTCCACGCCCTCTGCCTGCAGTGCGCGCTGTGCCAGGAGTACAGGCACCTCAAGAGCCTCGGCTACAAACCCTCGCTTGGCTGGCTCGGAAACAACCAGCACGTCCCGCCCAAGCACAACCCGCCGATGCGACGCTAA
Protein Sequence
  • >LOC_Os03g61440.1
    MARPQHNDWSSGLFACFNDCEVCCLTTVCPCITFGRSAEIVSRGERTCCAAGVMCVLLGFFAHCHCLYSCCYRGKMRDSFHLPEDPCCDCCVHALCLQCALCQEYRHLKSLGYKPSLGWLGNNQHVPPKHNPPMRR*