Gene Details:
- MSU gene ID: LOC_Os03g61440
- RAPdb gene ID: Os03g0829900
- Gene Symbol: OsFWL4
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Real-time PCR analysis showed that OsFWL4 expression was induced by CdCl2stress in rice seedlings.
- 2-like" (OsFWL) affects Cd resistance in yeast, and OsFWL4 mediates the translocation of Cd from roots to shoots.
- The Cd contents of OsFWL3-, -4-, -6- and -7-transformed Cd(II)-sensitive yeast mutant ycf1 cells were strongly decreased compared with those of empty vector, with the strongest resistance to Cd observed in cells expressing OsFWL4.
- Evaluation of truncated and site-directed mutation derivatives revealed that the CCXXG motifs near the second transmembrane region of OsFWL4 are involved in Cd resistance in yeast.
- These results suggest that OsFWL4 might act directly as a transporter and is involved in the translocation of Cd from roots to shoots in rice.
- The rice "fruit-weight 2.2-like" gene family member OsFWL4 is involved in the translocation of cadmium from roots to shoots.
Function-related keywords:
Literature:
- The rice fruit-weight 2.2-like gene family member OsFWL4 is involved in the translocation of cadmium from roots to shoots . DOI: 10.1007/s00425-018-2859-0 ; PMID: 29453663
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os03g61440.1
ATGGCGAGGCCGCAACACAATGACTGGTCATCCGGACTCTTCGCCTGCTTCAATGACTGCGAAGTTTGTTGCTTGACGACGGTGTGCCCGTGCATCACGTTCGGGCGGAGCGCGGAGATCGTGTCGAGGGGGGAGAGGACGTGCTGCGCGGCGGGCGTGATGTGCGTGCTGCTCGGCTTCTTCGCCCACTGCCACTGCCTCTACTCCTGCTGCTACCGCGGCAAGATGCGCGACAGCTTCCACCTCCCCGAGGACCCATGCTGCGACTGCTGCGTCCACGCCCTCTGCCTGCAGTGCGCGCTGTGCCAGGAGTACAGGCACCTCAAGAGCCTCGGCTACAAACCCTCGCTTGGCTGGCTCGGAAACAACCAGCACGTCCCGCCCAAGCACAACCCGCCGATGCGACGCTAA
CDS Sequence
- >LOC_Os03g61440.1
ATGGCGAGGCCGCAACACAATGACTGGTCATCCGGACTCTTCGCCTGCTTCAATGACTGCGAAGTTTGTTGCTTGACGACGGTGTGCCCGTGCATCACGTTCGGGCGGAGCGCGGAGATCGTGTCGAGGGGGGAGAGGACGTGCTGCGCGGCGGGCGTGATGTGCGTGCTGCTCGGCTTCTTCGCCCACTGCCACTGCCTCTACTCCTGCTGCTACCGCGGCAAGATGCGCGACAGCTTCCACCTCCCCGAGGACCCATGCTGCGACTGCTGCGTCCACGCCCTCTGCCTGCAGTGCGCGCTGTGCCAGGAGTACAGGCACCTCAAGAGCCTCGGCTACAAACCCTCGCTTGGCTGGCTCGGAAACAACCAGCACGTCCCGCCCAAGCACAACCCGCCGATGCGACGCTAA
Protein Sequence
- >LOC_Os03g61440.1
MARPQHNDWSSGLFACFNDCEVCCLTTVCPCITFGRSAEIVSRGERTCCAAGVMCVLLGFFAHCHCLYSCCYRGKMRDSFHLPEDPCCDCCVHALCLQCALCQEYRHLKSLGYKPSLGWLGNNQHVPPKHNPPMRR*