Information report for ZFP182;ZOS3-21
Gene Details
|
|
Functional Descriptions
- Overexpression of ZFP182 significantly enhanced multiple abiotic stress tolerances, including salt, cold and drought tolerances in transgenic rice.
- The expression analysis showed that ZFP182 gene was constitutively expressed in leaves, culms, roots and spikes at the adult rice plants, and markedly induced in the seedlings by cold (4 degrees C), 150 mM NaCl and 0.
- Nipponbare) C(2) H(2) -type ZFP ZFP182 in ABA-induced antioxidant defense and the relationship between ZFP182 and two rice MAPKs, OsMPK1 and OsMPK5 in ABA signaling were investigated.
- These results indicate that ZFP182 is required for ABA-induced antioxidant defense and the expression of ZFP182 is regulated by rice MAPKs in ABA signaling.
- The C2H2-type zinc finger protein ZFP182 is involved in abscisic acid-induced antioxidant defense in rice.
- Expression of ZFP182 in transgenic tobacco and overexpression in rice increased plant tolerance to salt stress.
- These results demonstrated that ZFP182 might be involved in plant responses to salt stress.
- ABA treatment induced the increases in the expression of ZFP182, OsMPK1 and OsMPK5, and the activities of superoxide dismutase (SOD) and ascorbate peroxidase (APX) in rice leaves.
- Besides, OsMPK1 and OsMPK5 were shown to be required for the up-regulation in the expression of ZFP182 in ABA signaling, but ZFP182 did not mediate the ABA-induced up-regulation in the expression of OsMPK1 and OsMPK5.
Functional Keywords
- abiotic-stress , drought-tolerance , drought , root , culm , defense , salt , ABA , salt-stress , seedling
Literature and News
- A novel rice C2H2-type zinc finger protein lacking DLN-box/EAR-motif plays a role in salt tolerance . DOI: 10.1016/j.bbaexp.2007.02.006 ; PMID: 17434609
- Genome-wide identification of C2H2 zinc-finger gene family in rice and their phylogeny and expression analysis . DOI: 10.1007/s11103-007-9199-y ; PMID: 17610133
- A TFIIIA-type zinc finger protein confers multiple abiotic stress tolerances in transgenic rice (Oryza sativa L.) . DOI: 10.1007/s11103-012-9955-5 ; PMID: 22930448
- The C2H2-type zinc finger protein ZFP182 is involved in abscisic acid-induced antioxidant defense in rice . DOI: 10.1111/j.1744-7909.2012.01135.x ; PMID: 22693960
Gene Resources
- UniProt: Q84T96
- EMBL: AK068861, AP014959, AY286474
- AlphaFoldDB: Q84T96
- EnsemblPlants: Os03t0820300-01
- Gramene: Os03t0820300-01
- KEGG: osa:4334592
- Orthologous matrix: ANANGCE
- InterPro: IPR013087, IPR036236
- PANTHER: PTHR26374, PTHR26374:SF418
- SUPFAM: SSF57667
- PROSITE: PS00028, PS50157
- Gene3D: 3.30.160.60
- OrthoDB: Q84T96
- eggNOG: KOG1721
Homologs
- Hordeum vulgare: MLOC_63032.1
- Panicum virgatum: Pavir.6NG205000.1.p, Pavir.5NG329600.1.p
- Setaria italica: Seita.9G034200.1.p
- Setaria viridis: Sevir.9G033300.1.p
- Triticum aestivum: Traes_5BL_3A9D3CEEF.2, Traes_5DL_50E35B4F3.1, Traes_5BL_BB99746DD.6
Sequences
cDNA Sequence
- >LOC_Os03g60560.1
ATCCATCGATCTCCCCCCAACCAAAAATCTCTCTCTCAATCCATCGATCCATTAATTCACAAGCTTATCGAATCGGAGATGAAGCACCCGAGGCAGGAGGAGGAGGTGTCGCTGGCGCTGGCGCTGAGCACGGACTGCTCGTCGACGGCGTCGGACTCGTCGGCGGCGGCGGCGGGCGGCGCGGCGAGGAGGAAGAGGGCGCGGCGGAGGAGCGTGGTGGCGACGTCGGGGGAAGGGGAGTTCGTGTGCAAGACTTGCAGCCGCGCGTTCCCGACCTTCCAGGCGCTCGGGGGCCACCGGACCAGCCACCTCCGCGGCCGGAGCAACGGGCTCGACCTCGGCGCCATCGGCGACAAGGCGATCAGGCTGCACAGGGCGGCCGACAAGGAGCACAGGGACAAGCACGAGTGCCACATCTGCGGCCTCGGCTTCGAGATGGGCCAGGCGCTCGGCGGACACATGCGGCGCCACCGCGAGGAGATGGCCGCCGCCGGCGGTGGATCCTCCGCCGACGACTGGGTCTGGCGCTGCGACGCGCGGCCGGAGGGGATCGCCGCCGAGCCACCGGTGTTGCTGGAGTTGTTCGCCTAGTTACCGCTGGTCTCCATTAGTTTCGTCCAAGTTTTGAACTGACGCAGTGTGTGTCACCATTAATTAGTTCATGTACATGTCTAGAAAAAAAAAGTCAGGTTCATCGATCTTGTAACTATGATAGGGGTTTAATTTTTTTTTTCATTAGCGTTTGGGTTGTTCGGTTTTGAATCGGTCAGTTTTTGAACCGTTTGGTGGAGATTTGTTGAGTTCAGATGTATATACACACACAGATGTAATATAATTCTTTCATTCATAGCTATACCTCTTGTAAATATATGCAACATTTATGTTTGTGCCAGAAATAAATTCAGCGCGCTGTTCCTCCTGATCA
CDS Sequence
- >LOC_Os03g60560.1
ATGAAGCACCCGAGGCAGGAGGAGGAGGTGTCGCTGGCGCTGGCGCTGAGCACGGACTGCTCGTCGACGGCGTCGGACTCGTCGGCGGCGGCGGCGGGCGGCGCGGCGAGGAGGAAGAGGGCGCGGCGGAGGAGCGTGGTGGCGACGTCGGGGGAAGGGGAGTTCGTGTGCAAGACTTGCAGCCGCGCGTTCCCGACCTTCCAGGCGCTCGGGGGCCACCGGACCAGCCACCTCCGCGGCCGGAGCAACGGGCTCGACCTCGGCGCCATCGGCGACAAGGCGATCAGGCTGCACAGGGCGGCCGACAAGGAGCACAGGGACAAGCACGAGTGCCACATCTGCGGCCTCGGCTTCGAGATGGGCCAGGCGCTCGGCGGACACATGCGGCGCCACCGCGAGGAGATGGCCGCCGCCGGCGGTGGATCCTCCGCCGACGACTGGGTCTGGCGCTGCGACGCGCGGCCGGAGGGGATCGCCGCCGAGCCACCGGTGTTGCTGGAGTTGTTCGCCTAG
Protein Sequence
- >LOC_Os03g60560.1
MKHPRQEEEVSLALALSTDCSSTASDSSAAAAGGAARRKRARRRSVVATSGEGEFVCKTCSRAFPTFQALGGHRTSHLRGRSNGLDLGAIGDKAIRLHRAADKEHRDKHECHICGLGFEMGQALGGHMRRHREEMAAAGGGSSADDWVWRCDARPEGIAAEPPVLLELFA*