OsNAC19;SNAC1

Gene Details

MSU gene ID: LOC_Os03g60080
RAPdb gene ID: Os03g0815100
Gene Symbol: OsNAC19 SNAC1 OsNAC9
Genome: MSU7 , IRGSP-1.0
Species: Oryza sativa

Functional Descriptions

Overexpression of OsDSR2 could increase salt and simulated drought (polyethyleneglycol)-stress sensitivities in rice by downregulating the expression of ABA- and stress-responsive genes including OsNCED4, SNAC1, OsbZIP23, P5CS, Oslea3 and rab16C.
The expression of OsNAC19 in rice leaves could be induced by the infection of blast fungus, and by application of exogenous methyl jasmonate (MeJA), ABA and ethylene but ethylene had a relatively weak induction effect.
The expression of gene OsNAC19 was high in rice seedling roots, culms and blade sheathes, but its expression in rice leaves was low.
Here, a rice homologue of SRO (similar to RCD one), termed OsSRO1c, was identified as a direct target gene of SNAC1 (stress-responsive NAC 1) involved in the regulation of stomatal aperture and oxidative response.
The results suggest that OsSRO1c has dual roles in drought and oxidative stress tolerance of rice by promoting stomatal closure and H(2)O(2) accumulation through a novel pathway involving regulators SNAC1 and DST.
The SNAC1-targeted gene OsSRO1c modulates stomatal closure and oxidative stress tolerance by regulating hydrogen peroxide in rice.
Such up-regulated genes that are commonly and specifically up-regulated in OsNAC9 transgenic roots may account for the altered root architecture conferring increased drought resistance phenotype.
The overexpression of OsNAC9 alters the root architecture of rice plants enhancing drought resistance and grain yield under field conditions.
Under drought conditions, RCc3:OsNAC9 plants showed an increased grain yield of 28%-72%, whilst the GOS2:OsNAC9 plants remained unchanged.
The aerenchyma of RCc3:OsNAC9 roots was enlarged to a greater extent than those of GOS2:OsNAC9 and non-transgenic (NT) roots, suggesting the importance of this phenotype for enhanced drought resistance.
Field evaluations over two cultivating seasons showed that grain yields of the RCc3:OsNAC9 and the GOS2:OsNAC9 plants were increased by 13%-18% and 13%-32% under normal conditions, respectively.
Here, we show that overexpression of stress responsive gene SNAC1 (STRESS-RESPONSIVE NAC 1) significantly enhances drought resistance in transgenic rice (22-34% higher seed setting than control) in the field under severe drought stress conditions at the reproductive stage while showing no phenotypic changes or yield penalty.
The OsSKIPa-overexpressing rice showed significantly increased reactive oxygen species-scavenging ability and transcript levels of many stress-related genes, including SNAC1 and rice homologs of CBF2, PP2C, and RD22, under drought stress conditions.
Our data suggest that SNAC1 holds promising utility in improving drought and salinity tolerance in rice.
In this research, a full-length cDNA clone OsNAC19 (Oryza sativa NAC19), encoding a novel NAC-domain protein, was isolated from a cDNA library prepared with rice leaves infected by incompatible race 131 of blast fungus (Magnaporthe grisea).
SNAC1 is induced predominantly in guard cells by drought and encodes a NAM, ATAF, and CUC (NAC) transcription factor with transactivation activity.
Root-specific (RCc3) and constitutive (GOS2) promoters were used to overexpress OsNAC9 and produced the transgenic RCc3:OsNAC9 and GOS2:OsNAC9 plants.
Interestingly, O-methyltransferase, a gene necessary for barrier formation, was specifically up-regulated only in the RCc3:OsNAC9 roots.
Rice gene OsNAC19 encodes a novel NAC-domain transcription factor and responds to infection by Magnaporthe grisea.
A stress-responsive NAC transcription factor gene SNAC1 has been reported for its function in the positive regulation of drought resistance in rice, and several downstream SNAC1 targets have been identified.
However, a complete regulatory network mediated by SNAC1 in drought response remains unknown.
In this study, we performed Chromatin immunoprecipitation sequencing (ChIP-Seq) and RNA-Seq of SNAC1-overexpression transgenic rice (SNAC1-OE) lines and wild-type under normal and moderate drought stress conditions, to identify all SNAC1 target genes at a genome-wide scale by RNA-Seq analyses.
SNAC1 can bind to the OsbZIP23 promoter, an important ABA signaling regulator, and positively regulate the expression of several ABA signaling genes.

Functional Keywords

Literature and News

Gene Resources

Sequences

cDNA Sequence

>LOC_Os03g60080.1
CATTCGAGAAATCCCTCACAACCCACAACATTTTCAAACAACGCAAAGCAGTAGCAGCAGCGAGAAGCAAGCAAGAAGCGATGGGGATGGGGATGAGGAGGGAGAGGGACGCGGAGGCGGAGCTGAACCTGCCGCCGGGGTTCAGGTTCCACCCCACGGACGACGAGCTGGTGGAGCACTACCTGTGCAGGAAGGCGGCGGGGCAGCGCCTGCCGGTGCCGATCATCGCCGAGGTGGATCTCTACAAGTTCGACCCGTGGGATCTGCCCGAGCGCGCGCTGTTCGGCGCCAGGGAGTGGTACTTCTTCACCCCGCGGGATCGCAAGTATCCTAATGGGTCACGCCCCAACCGCGCCGCCGGCAACGGGTACTGGAAGGCCACCGGCGCCGACAAGCCCGTCGCGCCGCGGGGGCGCACGCTTGGGATCAAGAAGGCGCTCGTGTTCTACGCCGGCAAGGCGCCGCGAGGGGTCAAGACTGATTGGATCATGCATGAGTACCGGCTCGCCGATGCTGGCCGCGCCGCCGCGGGCGCCAAGAAGGGATCTCTCAGGTTGGATGATTGGGTGCTGTGTCGGCTGTACAACAAGAAGAACGAGTGGGAGAAGATGCAGCAGGGGAAGGAGGTGAAGGAGGAGGCGTCCGACATGGTTACGTCGCAGTCGCACTCGCACACCCACTCGTGGGGCGAGACGCGCACGCCGGAGTCGGAGATCGTGGACAACGACCCCTTCCCGGAGCTGGACTCGTTCCCGGCGTTCCAGCCTGCGCCGCCGCCGGCGACGGCGATGATGGTGCCCAAGAAAGAATCGATGGACGACGCCACCGCGGCCGCCGCCGCCGCCGCCACCATCCCCAGGAACAACAGCAGCCTGTTCGTGGACCTGAGCTACGACGATATCCAGGGCATGTACAGCGGCCTCGACATGCTGCCGCCGGGCGACGACTTCTACTCGTCGCTCTTCGCGTCGCCGCGGGTGAAGGGGACGACGCCACGCGCCGGCGCCGGCATGGGCATGGTCCCGTTCTGAGGTGACGGCGACGCGATCGAACAGGTGGTGATCGATGCTGCAACGTGTGTAAATATACAGCGCCGGCTGGGTCAAGAGATGGCTCGGGTGACGCGCGCGCGGCGTGTCCTGGCGTTGGCGCCGGGGCATTCTTTAGTTTTTCATCTTTTCATCATCTCAGATGGTAGATACAAAACAGTGTATGTATGTAGCTCTGTTTCTCTCTATAGAACCCCAACAAATTTTGTTGTTGATGTTGTTTATCTTCATATGCTTTGATCTTGAAATCGTCTACCTTACTACTGCCGA

CDS Sequence

>LOC_Os03g60080.1
ATGGGGATGGGGATGAGGAGGGAGAGGGACGCGGAGGCGGAGCTGAACCTGCCGCCGGGGTTCAGGTTCCACCCCACGGACGACGAGCTGGTGGAGCACTACCTGTGCAGGAAGGCGGCGGGGCAGCGCCTGCCGGTGCCGATCATCGCCGAGGTGGATCTCTACAAGTTCGACCCGTGGGATCTGCCCGAGCGCGCGCTGTTCGGCGCCAGGGAGTGGTACTTCTTCACCCCGCGGGATCGCAAGTATCCTAATGGGTCACGCCCCAACCGCGCCGCCGGCAACGGGTACTGGAAGGCCACCGGCGCCGACAAGCCCGTCGCGCCGCGGGGGCGCACGCTTGGGATCAAGAAGGCGCTCGTGTTCTACGCCGGCAAGGCGCCGCGAGGGGTCAAGACTGATTGGATCATGCATGAGTACCGGCTCGCCGATGCTGGCCGCGCCGCCGCGGGCGCCAAGAAGGGATCTCTCAGGTTGGATGATTGGGTGCTGTGTCGGCTGTACAACAAGAAGAACGAGTGGGAGAAGATGCAGCAGGGGAAGGAGGTGAAGGAGGAGGCGTCCGACATGGTTACGTCGCAGTCGCACTCGCACACCCACTCGTGGGGCGAGACGCGCACGCCGGAGTCGGAGATCGTGGACAACGACCCCTTCCCGGAGCTGGACTCGTTCCCGGCGTTCCAGCCTGCGCCGCCGCCGGCGACGGCGATGATGGTGCCCAAGAAAGAATCGATGGACGACGCCACCGCGGCCGCCGCCGCCGCCGCCACCATCCCCAGGAACAACAGCAGCCTGTTCGTGGACCTGAGCTACGACGATATCCAGGGCATGTACAGCGGCCTCGACATGCTGCCGCCGGGCGACGACTTCTACTCGTCGCTCTTCGCGTCGCCGCGGGTGAAGGGGACGACGCCACGCGCCGGCGCCGGCATGGGCATGGTCCCGTTCTGA

Protein Sequence

>LOC_Os03g60080.1
MGMGMRRERDAEAELNLPPGFRFHPTDDELVEHYLCRKAAGQRLPVPIIAEVDLYKFDPWDLPERALFGAREWYFFTPRDRKYPNGSRPNRAAGNGYWKATGADKPVAPRGRTLGIKKALVFYAGKAPRGVKTDWIMHEYRLADAGRAAAGAKKGSLRLDDWVLCRLYNKKNEWEKMQQGKEVKEEASDMVTSQSHSHTHSWGETRTPESEIVDNDPFPELDSFPAFQPAPPPATAMMVPKKESMDDATAAAAAAATIPRNNSSLFVDLSYDDIQGMYSGLDMLPPGDDFYSSLFASPRVKGTTPRAGAGMGMVPF*