Information report for OsNAS2
Gene Details
|
|
Functional Descriptions
- OsNAS1 and OsNAS2 transcripts were detected in Fe-sufficient roots but not in leaves, and levels of both increased markedly in both roots and leaves in response to Fe deficiency.
- Promoter-GUS analysis revealed that OsNAS1 and OsNAS2 were expressed in Fe-sufficient roots in companion cells and pericycle cells adjacent to the protoxylem.
- With Fe deficiency, OsNAS1 and OsNAS2 expression extended to all root cells along with an increase in phytosiderophore secretion.
- Activation of iron deficiency-inducible OsNAS2 resulted in a rise in Fe content (3.
- Activation of Rice nicotianamine synthase 2 (OsNAS2) enhances iron availability for biofortification.
- RNA interference of OsIRO2 in transgenic rice showed that ethylene acted via this transcription factor to induce the expression of OsNAS1, OsNAS2, OsYSL15, and OsIRT1.
- Mice fed with OsNAS2-D1 seeds recovered more rapidly from a zinc deficiency than did control mice receiving WT seeds.
- These results demonstrate that the level of bio-available zinc in rice grains can be enhanced significantly by activation tagging of OsNAS2.
- Mice fed with OsNAS2-D1 seeds recovered more rapidly from anemia, indicating that bioavailable Fe contents were improved by this increase in OsNAS2 expression.
- In the endosperm, the OsNAS2 activation-tagged line contained up to 20-fold more NA and 2.
- In Fe-deficient plants, OsNAS1 and OsNAS2 were expressed in the vascular bundles of green leaves and in all cells of leaves showing severe chlorosis.
- Three rice nicotianamine synthase genes, OsNAS1, OsNAS2, and OsNAS3 are expressed in cells involved in long-distance transport of iron and differentially regulated by iron.
- We obtained significant increases of iron and zinc content in wheat grains of plants expressing either OsNAS2 or PvFERRTIN, or both genes.
- Our research suggests that simultaneous activation of OsNAS2 and OsNAS3 can enhance Fe and Zn accumulation in rice grains while also increasing plant tolerance to growing situations with metal deficiency and excess metal availability.
- Concomitant Activation of OsNAS2 and OsNAS3 Contributes to the Enhanced Accumulation of Iron and Zinc in Rice.
Functional Keywords
Literature and News
- Ethylene is involved in the regulation of iron homeostasis by regulating the expression of iron-acquisition-related genes in Oryza sativa . DOI: 10.1093/jxb/erq301 ; PMID: 21112958
- A receptor-like protein RMC is involved in regulation of iron acquisition in rice . DOI: 10.1093/jxb/ert290 ; PMID: 24014863
- Three rice nicotianamine synthase genes, OsNAS1, OsNAS2, and OsNAS3 are expressed in cells involved in long-distance transport of iron and differentially regulated by iron . DOI: 10.1046/j.1365-313x.2003.01878.x ; PMID: 14617093
- The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes . DOI: 10.1111/j.1365-313X.2009.04015.x ; PMID: 19737364
- Bio-available zinc in rice seeds is increased by activation tagging of nicotianamine synthase . DOI: 10.1111/j.1467-7652.2011.00606.x ; PMID: 21426477
- Activation of Rice nicotianamine synthase 2 (OsNAS2) enhances iron availability for biofortification . DOI: 10.1007/s10059-012-2231-3 ; PMID: 22228185
- OsIRO2 is responsible for iron utilization in rice and improves growth and yield in calcareous soil . DOI: 10.1007/s11103-011-9752-6 ; PMID: 21331630
- Rice NICOTIANAMINE SYNTHASE 2 expression improves dietary iron and zinc levels in wheat . DOI: 10.1007/s00122-016-2808-x ; PMID: 27722771
- Comparative transcriptome profile analysis of rice varieties with different tolerance to zinc deficiency . DOI: 10.1111/plb.13227 ; PMID: 33296551
- Concomitant Activation of OsNAS2 and OsNAS3 Contributes to the Enhanced Accumulation of Iron and Zinc in Rice . DOI: 10.3390/ijms24076568 ; PMID: 37047538
Gene Resources
- UniProt: Q10MI9
- EMBL: AK112011, AP008209, AP014959
- AlphaFoldDB: Q10MI9
- EnsemblPlants: Os03t0307200-01
- Gramene: Os03t0307200-01
- KEGG: dosa:Os03g0307200
- Orthologous matrix: NNRGMEK
- InterPro: IPR004298, IPR029063
- PANTHER: PTHR32266, PTHR32266:SF10
- SUPFAM: SSF53335
- PROSITE: PS51142
- Gene3D: 3.40.50.150
- OrthoDB: Q10MI9
- SWISS-MODEL: Q10MI9
- eggNOG: ENOG502QTU6
Sequences
cDNA Sequence
- >LOC_Os03g19420.2
ATCAAGCAGCTCAAGCATTCCACAAGCTTGCCGTTTTCCACTGACAGCTCAAGTGCTCGTGCAACATTAGCTGATCAGCTCGTGTTCCCAACCGCGACAAAGCTTCACAGATGGAGGCTCAGAACCAAGAGGTCGCTGCCCTGGTCGAGAAGATCGCCGGCCTCCACGCCGCCATCTCCAAGCTGCCGTCGCTGAGCCCATCCGCCGAGGTGGACGCGCTCTTCACCGACCTCGTCACGGCGTGCGTCCCGGCGAGCCCCGTCGACGTGGCCAAGCTCGGCCCGGAGGCGCAGGCGATGCGGGAGGAGCTCATCCGCCTCTGCTCCGCCGCCGAGGGCCACCTCGAGGCGCACTACGCCGACATGCTCGCCGCCTTCGACAACCCGCTCGACCACCTCGCCCGCTTCCCGTACTACGGCAACTACGTCAACCTGAGCAAGCTGGAGTACGACCTCCTCGTCCGCTACGTCCCCGGCATTGCCCCCACCCGCGTCGCCTTCGTCGGGTCGGGCCCGCTGCCGTTCAGCTCCCTCGTGCTCGCCGCGCACCACCTGCCGGACGCGGTGTTCGACAACTACGACCGGTGCGGCGCGGCCAACGAGCGGGCGAGGAGGCTGTTCCGCGGCGCCGACGAGGGCCTCGGCGCGCGCATGGCGTTCCACACCGCCGACGTGGCGACCCTGACGGGGGAGCTCGGCGCGTACGACGTCGTGTTCCTGGCGGCGCTCGTGGGCATGGCGGCCGAGGAGAAGGCCGGGGTGATCGCGCACCTGGGCGCGCACATGGCGGACGGCGCGGCGCTCGTCGTGCGGAGCGCGCACGGGGCGCGCGGGTTCCTGTACCCGATCGTCGATCTCGAGGACATCCGGCGGGGCGGGTTCGACGTGCTGGCCGTGTACCACCCCGACGACGAGGTGATCAACTCCGTCATCGTCGCTCGCAAGGCCGACCCGCGTCGCGGCGGCGGGCTCGCCGGCGCACGCGGCGCGGTTCCAGTGGTGAGCCCGCCGTGCAAGTGCTGCAAGATGGAGGCGGCCGCCGGCGCGTTCCAGAAGGCGGAAGAGTTCGCCGCCAAGAGGCTATCCGTCTGAGTGCGTGCATAGTAATCCTGGCTGTGTCTCGCTGTCCGTGACATCGGCCGGCTGAAACATTATTGGTATCGGTTTGTGTTTGTGCTTCTGTGGGGTTCTTGTTCTTGTTGTGTGGATGATGCTAGGCGCCTGGGCATTGATCCGTGCCAATGCATTCCGTGTTTCGGTGCAACTCTAGGGGACAACGACGAGTAAGGTGCTGAGAAAGCAAGAGGTGTTTGTCACCGTCTGAAATAATAATGTAAAAGGGTTATCTACGTGAACTTCGATCACGACAGTCTTGAGTAGGTACCCGTGTGGTACCACTTCAAGACCCATAATTTTTGTAAATAAATTTTACAAAACTATCAAACTATTCAAAGCTAGAGATTTAAGGCGGTACATCATGAAA
CDS Sequence
- >LOC_Os03g19420.2
ATGGAGGCTCAGAACCAAGAGGTCGCTGCCCTGGTCGAGAAGATCGCCGGCCTCCACGCCGCCATCTCCAAGCTGCCGTCGCTGAGCCCATCCGCCGAGGTGGACGCGCTCTTCACCGACCTCGTCACGGCGTGCGTCCCGGCGAGCCCCGTCGACGTGGCCAAGCTCGGCCCGGAGGCGCAGGCGATGCGGGAGGAGCTCATCCGCCTCTGCTCCGCCGCCGAGGGCCACCTCGAGGCGCACTACGCCGACATGCTCGCCGCCTTCGACAACCCGCTCGACCACCTCGCCCGCTTCCCGTACTACGGCAACTACGTCAACCTGAGCAAGCTGGAGTACGACCTCCTCGTCCGCTACGTCCCCGGCATTGCCCCCACCCGCGTCGCCTTCGTCGGGTCGGGCCCGCTGCCGTTCAGCTCCCTCGTGCTCGCCGCGCACCACCTGCCGGACGCGGTGTTCGACAACTACGACCGGTGCGGCGCGGCCAACGAGCGGGCGAGGAGGCTGTTCCGCGGCGCCGACGAGGGCCTCGGCGCGCGCATGGCGTTCCACACCGCCGACGTGGCGACCCTGACGGGGGAGCTCGGCGCGTACGACGTCGTGTTCCTGGCGGCGCTCGTGGGCATGGCGGCCGAGGAGAAGGCCGGGGTGATCGCGCACCTGGGCGCGCACATGGCGGACGGCGCGGCGCTCGTCGTGCGGAGCGCGCACGGGGCGCGCGGGTTCCTGTACCCGATCGTCGATCTCGAGGACATCCGGCGGGGCGGGTTCGACGTGCTGGCCGTGTACCACCCCGACGACGAGGTGATCAACTCCGTCATCGTCGCTCGCAAGGCCGACCCGCGTCGCGGCGGCGGGCTCGCCGGCGCACGCGGCGCGGTTCCAGTGGTGAGCCCGCCGTGCAAGTGCTGCAAGATGGAGGCGGCCGCCGGCGCGTTCCAGAAGGCGGAAGAGTTCGCCGCCAAGAGGCTATCCGTCTGA
Protein Sequence
- >LOC_Os03g19420.2
MEAQNQEVAALVEKIAGLHAAISKLPSLSPSAEVDALFTDLVTACVPASPVDVAKLGPEAQAMREELIRLCSAAEGHLEAHYADMLAAFDNPLDHLARFPYYGNYVNLSKLEYDLLVRYVPGIAPTRVAFVGSGPLPFSSLVLAAHHLPDAVFDNYDRCGAANERARRLFRGADEGLGARMAFHTADVATLTGELGAYDVVFLAALVGMAAEEKAGVIAHLGAHMADGAALVVRSAHGARGFLYPIVDLEDIRRGGFDVLAVYHPDDEVINSVIVARKADPRRGGGLAGARGAVPVVSPPCKCCKMEAAAGAFQKAEEFAAKRLSV*