OsCYP2;OsCyp2-P

Gene Details

MSU gene ID: LOC_Os02g02890
RAPdb gene ID: Os02g0121300
Gene Symbol: OsCYP2 OsCyp2-P LRT2
Genome: MSU7 , IRGSP-1.0
Species: Oryza sativa

Functional Descriptions

OsCYP2, a chaperone involved in degradation of auxin-responsive proteins, plays crucial roles in rice lateral root initiation.
Proteomic identification of OsCYP2, a rice cyclophilin that confers salt tolerance in rice (Oryza sativa L.) seedlings when overexpressed.
Heterologous expression of a salinity and developmentally regulated rice cyclophilin gene (OsCYP2) in E. coli and S. cerevisiae confers tolerance towards multiple abiotic stresses.
Our results suggest that OsCYP2 participates in auxin signal transduction by interacting with OsSGT1.
Expression of OsCYP2 enhances the ability of Escherichia coli to survive under diverse abiotic stresses viz.
Based on these results, we propose that OsCYP2 may serve as a ‘suitable candidate’ for raising transgenic plants for enhanced multiple abiotic stress tolerance.
OsCYP2 was able to complement the yeast mutant lacking native Cyp2 and also improved the growth of wild type yeast under above-mentioned stress conditions.
Ectopic expression of OsCyp2-P imparted multiple abiotic stress tolerance to transgenic tobacco plants as evidenced by higher root length, shoot length, chlorophyll content, and K(+)/Na(+) ratio under stress conditions.
Expression of a cyclophilin OsCyp2-P isolated from a salt-tolerant landrace of rice in tobacco alleviates stress via ion homeostasis and limiting ROS accumulation.
OsCyp2-P operates via reactive oxygen species (ROS) scavenging and ion homeostasis and thus is a promising candidate gene for enhancing multiple abiotic stress tolerance in crop plants.
The overall results suggest the explicit role of OsCyp2-P in bestowing multiple abiotic stress tolerance at the whole plant level.
Publicly available massively parallel signature sequencing (MPSS) and microarray data, besides our quantitative real time PCR (qRT-PCR) data suggest that transcript abundance of OsCyp2-P is regulated under different stress conditions in a developmental and organ specific manner.
Moreover, knockdown of the OsIAA11 expression partially rescues the LRT2 mutant phenotype in lateral root development.
To better understand the molecular mechanisms underlying lateral root formation, an auxin-responsive gene OsCYP2 (Os02g0121300) was characterized from rice.
T2 OsZFP-RNAi lines had significantly fewer lateral roots than did wild-type plants, which suggests a role for OsCYP2 and OsZFP in regulating lateral root development.
These findings imply that OsCYP2 and OsZFP participate in IAA signal pathways controlling lateral root development.
Yeast two-hybrid and glutathione S-transferase pull-down results confirmed that OsCYP2 interacted with a C2HC-type zinc finger protein (OsZFP, Os01g0252900) which is located in the rice nucleus.
In rice, a tryptophan-proline (W-P) cis-trans switch in transcription repressor protein OsIAA11 along with its associated cyclophilin LRT2 are essential components in a negative feedback gene regulation circuit that controls lateral root initiation in response to the plant hormone auxin.
Here we present NMR studies that determine and independently validate these parameters for LRT2 catalysis of the W-P motif in OsIAA11, providing predictive power for understanding the role of this switch in the auxin-responsive circuit and the resulting lateral rootless phenotype in rice.
Binding of the transcription factor MYC2-like to the ABRE of the OsCYP2 promoter enhances salt tolerance in Oryza sativa.

Functional Keywords

Literature and News

Gene Resources

Sequences

cDNA Sequence

>LOC_Os02g02890.1
TCAGGCCACGCAGCGATCTGAAGTGAAACAGCAAAAAAAATCAAACAAAAAGAAAAAATATTCCCCATCTGTGAAATTCGCAAAACCCTAGCGCGGCGGCGATGTCGAACACGAGGGTGTTCTTCGACATGACCGTCGGCGGAGCTCCGGCGGGGCGGATCGTGATGGAGCTGTACGCGAAGGACGTGCCGCGGACGGCGGAGAACTTCCGCGCGCTCTGCACCGGCGAGAAGGGCGTGGGCAAGAGCGGCAAGCCGCTGCACTACAAGGGGAGCACCTTCCACCGCGTGATCCCGGAGTTCATGTGCCAGGGCGGCGACTTCACCCGCGGCAACGGCACGGGAGGGGAGTCGATCTACGGCGAGAAGTTCGCCGACGAGGTGTTCAAGTTCAAGCACGACAGCCCCGGCATCCTGTCCATGGCGAACGCCGGGCCCAACACTAACGGGTCCCAGTTCTTCATCTGCACCGTGCCCTGCAGCTGGCTGGACGGGAAGCACGTCGTGTTCGGCCGCGTCGTCGAGGGCATGGACGTCGTCAAGGCCATCGAGAAGGTGGGATCCCGCGGCGGGAGCACCGCCAAGCCGGTCGTCATCGCCGACTGCGGCCAGCTCTCCTAGATCTGTGCTGTTCCCCTTCGCCTTTCGCCAGTATCAGTCGTCTTGAGTCGTCGAGTCCCTAAATAAGGAGGAGGTGGTGGTGGTGTTAGTCTTTTTATGAGTTCGTGTCGTGTTGGTGAGATGAGATCGCCCATGGTTTGGTTGGATTAGGCGGAGTTCTTGGATCGATTCGGTGGAGTTGGATCTGCGATCCTTCTTGGGGTTGGTTTTAAATCTTAATTCGTGTCGCTGCTTCTATGATATCGCTATCAATCAATGAGAACATTTGGGATCCGTGGATTTTCTGTGATCTTACACCTGTGTGGTTGTTTGTTCTTGCGACAGTACTAACGTTCTTGCGATTAAAGTAGATTAAACTATCTTCGTGAGATGAGCGGTTTGTCGCCGCGTGATGCCTGACTTTGATGTGATTTGTGGGACTTCGTCTTATCCATTTGGTTATTATTATTTTTTTATTT

CDS Sequence

>LOC_Os02g02890.1
ATGTCGAACACGAGGGTGTTCTTCGACATGACCGTCGGCGGAGCTCCGGCGGGGCGGATCGTGATGGAGCTGTACGCGAAGGACGTGCCGCGGACGGCGGAGAACTTCCGCGCGCTCTGCACCGGCGAGAAGGGCGTGGGCAAGAGCGGCAAGCCGCTGCACTACAAGGGGAGCACCTTCCACCGCGTGATCCCGGAGTTCATGTGCCAGGGCGGCGACTTCACCCGCGGCAACGGCACGGGAGGGGAGTCGATCTACGGCGAGAAGTTCGCCGACGAGGTGTTCAAGTTCAAGCACGACAGCCCCGGCATCCTGTCCATGGCGAACGCCGGGCCCAACACTAACGGGTCCCAGTTCTTCATCTGCACCGTGCCCTGCAGCTGGCTGGACGGGAAGCACGTCGTGTTCGGCCGCGTCGTCGAGGGCATGGACGTCGTCAAGGCCATCGAGAAGGTGGGATCCCGCGGCGGGAGCACCGCCAAGCCGGTCGTCATCGCCGACTGCGGCCAGCTCTCCTAG

Protein Sequence

>LOC_Os02g02890.1
MSNTRVFFDMTVGGAPAGRIVMELYAKDVPRTAENFRALCTGEKGVGKSGKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVFKFKHDSPGILSMANAGPNTNGSQFFICTVPCSWLDGKHVVFGRVVEGMDVVKAIEKVGSRGGSTAKPVVIADCGQLS*