Gene Details:
- MSU gene ID: LOC_Os01g70440
- RAPdb gene ID: Os01g0929600
- Gene Symbol: RTS
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Light and near-infrared confocal microscopy of cross-sections through developing flowers of male-sterile transgenics shows that tissue-specific expression of barnase or the antisense RTS genes interrupts tapetal development, resulting in deformed non-viable pollen.
- These results demonstrate a critical role of the RTS gene in pollen development in rice and the versatile application of the RTS gene promoter in directing anther-specific gene expression in both monocotyledonous and dicotyledonous plants, pointing to a potential for exploiting this gene and its promoter for engineering male sterility for hybrid production of various plant species.
- A tapetum-specific gene, RTS, has been isolated by differential screening of a cDNA library from rice panicles.
- Transgenic and antisense RNA approaches revealed that RTS gene is required for male fertility in rice.
- RTS, a rice anther-specific gene is required for male fertility and its promoter sequence directs tissue-specific gene expression in different plant species.
- Several other sequence motifs found in other anther-specific promoters were also identified in the promoter of the RTS gene.
Function-related keywords:
Literature:
- RTS, a rice anther-specific gene is required for male fertility and its promoter sequence directs tissue-specific gene expression in different plant species . DOI: 10.1007/s11103-006-9031-0 ; PMID: 16897470
Related News:
Gene Resources:
- NCBI ID: U12171
- UniProt accessions:
Sequences:
cDNA Sequence
- >LOC_Os01g70440.1
TGCATCATCATCATCAGCTCGATAGAAAAAGAAAGAAATTAAAAAGAAAATCACGGCGCGTGAGCTTGCAGAGACAGCAATGGTGAGAGTTGGTGCCGCCGCGGCGGTGCTCGTGCTGGCGGCGGCGGCGGCGGCCATGGCCGCCGAGCCGCCCACCGATGACGGCGCGGTCCGGGTGGCGGCGGGGCTGACGAAGTGCGTGTCCGGGTGCGGTAGCAAGGTGACCTCCTGCTTGCTCGGCTGCTACGGCGGCGGCGGCGGCGCCGCCGCCGCCGCGACGGCGATGCCGTTCTGCGTCATCGGCTGCACCAGCGACGTCTTGTCCTGCGCCACCGGCTGCTCCACCTCGCTCTGATTAAGTACTAATGAAGTAATTAACCGCGCTAATTAATAATAAATCGCACCTACGTATGCCACATGTGGACTCGCTTGACTAATTAAATACTGCCATGCGAATGCGATTAGTGGATTATGAAAAGAGGAAATGTAAGAACTCATGGCTCTCTCTGTGCCATGCCTGTACTGCATTGAAATGAATCTGCATGCAGCCATGAACTGATATACAAATACGACCATGTTACCTGTAATCTCTCCATCATGTGGGGCTTTCATGCTTTAATAACGTGTGATATTGATATTATGTGATTAATTGT
CDS Sequence
- >LOC_Os01g70440.1
ATGGTGAGAGTTGGTGCCGCCGCGGCGGTGCTCGTGCTGGCGGCGGCGGCGGCGGCCATGGCCGCCGAGCCGCCCACCGATGACGGCGCGGTCCGGGTGGCGGCGGGGCTGACGAAGTGCGTGTCCGGGTGCGGTAGCAAGGTGACCTCCTGCTTGCTCGGCTGCTACGGCGGCGGCGGCGGCGCCGCCGCCGCCGCGACGGCGATGCCGTTCTGCGTCATCGGCTGCACCAGCGACGTCTTGTCCTGCGCCACCGGCTGCTCCACCTCGCTCTGA
Protein Sequence
- >LOC_Os01g70440.1
MVRVGAAAAVLVLAAAAAAMAAEPPTDDGAVRVAAGLTKCVSGCGSKVTSCLLGCYGGGGGAAAAATAMPFCVIGCTSDVLSCATGCSTSL*