Information report for AP37;OsERF3
Gene Details
|
|
Functional Descriptions
- The overexpression of AP37 and AP59 in rice under the control of the constitutive promoter OsCc1 increased the tolerance to drought and high salinity at the vegetative stage.
- More importantly, the OsCc1:AP37 plants showed significantly enhanced drought tolerance in the field, which increased grain yield by 16% to 57% over controls under severe drought conditions, yet exhibited no significant difference under normal growth conditions.
- Our results suggest that the AP37 gene has the potential to improve drought tolerance in rice without causing undesirable growth phenotypes.
- Overexpression of the Transcription Factor AP37 in Rice Improves Grain Yield under Drought Conditions.
- We discovered a nucleus-localized ERF gene in rice (Oryza sativa), OsERF3, that was rapidly up-regulated in response to feeding by the rice striped stem borer (SSB) Chilo suppressalis.
- These results suggest that OsERF3, an AP2 (APETALA 2 Gene)/ERF transcription factor, binds the LRK6 promoter at this new motif, which might cause differential expression of LRK6 in the 93-11/Nipponbare hybrid.
- Here, we first revealed that the expression of OsERF3 was induced by drought, salt, ACC and ABA treatment.
- Increased tolerance to low temperatures was observed only in OsCc1:AP37 plants.
- OsERF3 is a transcriptional repressor with an ethylene-responsive element-binding factor-associated amphiphilic repression (EAR) motif (F/LDLNxxP), which transcriptionally represses the ethylene emission and drought tolerance in rice.
- Thus, our data reveal that the EAR motif is required for OsERF3 to transcriptionally regulate the ethylene synthesis and drought tolerance in rice, providing new insight to the roles of ethylene-response factor proteins in regulating ethylene biosynthesis and stress response.
- EAR motif mutation of rice OsERF3 alters the regulation of ethylene biosynthesis and drought tolerance.
- We propose that OsERF3 affects early components of herbivore-induced defense responses by suppressing MAPK repressors and modulating JA, SA, ethylene and H(2)O(2) pathways as well as plant resistance.
- On the other hand, OsERF3 was slightly suppressed by the rice brown planthopper (BPH) Nilaparvata lugens (Stål) and increased susceptibility to this piercing sucking insect, possibly by suppressing H(2)O(2) biosynthesis.
- Our results also illustrate that OsERF3 acts as a central switch that gears the plant’s metabolism towards an appropriate response to chewing or piercing/sucking insects.
- Antisense and over-expression of OsERF3 revealed that it positively affects transcript levels of two mitogen-activated protein kinases (MAPKs) and two WRKY genes as well as concentrations of jasmonate (JA), salicylate (SA) and the activity of trypsin protease inhibitors (TrypPIs).
- Moreover, overexpression of OsERF3/OsAP2-39 suppressed ethylene synthesis.
- In addition, application of ACC recovered the drought-sensitive phenotype in the lines overexpressing OsERF3, showing that ethylene production contributed to drought response in rice.
- Transcriptional activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene synthesis and drought tolerance in rice.
- Functional analysis revealed that ERF3 was essential for crown root development and acts in auxin- and cytokinin-responsive gene expression.
- Also, increased expression of ERF3 could partially complement wox11, indicating that the two genes functioned cooperatively to regulate crown root development.
- Furthermore, ERF3-regulated RR2 expression was involved in crown root initiation, while the ERF3/WOX11 interaction likely repressed RR2 during crown root elongation.
Functional Keywords
- drought , stem , salinity , transcription-factor , ABA , temperature , ethylene , growth , defense , grain , yield , insect , jasmonate , grain-yield , brown-planthopper , defense-response , vegetative , drought-tolerance , salt , crown-root-development , root-development , root , auxin , cytokinin , crown-root-elongation , root-elongation , crown-root-initiation , root-initiation
Literature and News
- Identification and characterization of a novel water-deficit-suppressed gene OsARD encoding an aci-reductone-dioxygenase-like protein in rice . DOI: 10.1016/j.gene.2005.07.017 ; PMID: 16169685
- EAR motif mutation of rice OsERF3 alters the regulation of ethylene biosynthesis and drought tolerance . DOI: 10.1007/s00425-013-1852-x ; PMID: 23420309
- An EAR-motif-containing ERF transcription factor affects herbivore-induced signaling, defense and resistance in rice . DOI: 10.1111/j.1365-313X.2011.04709.x ; PMID: 21831212
- Transcriptional activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene synthesis and drought tolerance in rice . DOI: 10.1371/journal.pone.0025216 ; PMID: 21966459
- Expression characteristics of OS-ACS1 and OS-ACS2, two members of the 1-aminocyclopropane-1-carboxylate synthase gene family in rice (Oryza sativa L. cv. Habiganj Aman II) during partial submergence . DOI: 10.1023/b:plan.0000009693.26740.c3 ; PMID: 9037160
- Isolation and identification of an AP2/ERF factor that binds an allelic cis-element of rice gene LRK6 . DOI: 10.1017/S0016672311000218 ; PMID: 21854687
- Overexpression of the transcription factor AP37 in rice improves grain yield under drought conditions . DOI: 10.1104/pp.109.137554 ; PMID: 19429605
Gene Resources
- UniProt: A0A8J8Y8U7
- EMBL: AP003299, AP008207, CM000138
- EnsemblPlants: Os01t0797600-01
- Gramene: Os01t0797600-01
- KEGG: dosa:Os01g0797600, osa:4327621
- Orthologous matrix: VGMGPHY
- InterPro: IPR001471, IPR016177, IPR036955
- PANTHER: PTHR31677, PTHR31677:SF168
- SUPFAM: SSF54171
- PROSITE: PS51032
- Gene3D: 3.30.730.10
- OrthoDB: A0A8J8Y8U7
- SWISS-MODEL: A0A8J8Y8U7
- Conserved Domain Database: cd00018
Homologs
- Brachypodium distachyon: Bradi2g52370.1.p
- Hordeum vulgare: MLOC_24530.1
- Panicum virgatum: Pavir.5NG539500.1.p, Pavir.5KG581300.1.p
- Setaria italica: Seita.5G348000.1.p
- Setaria viridis: Sevir.5G352700.1.p
- Triticum aestivum: TaERF3-3A, TaERF3-3B, TRAES3BF075600050CFD_t1
- Zea mays: GRMZM2G310368_P01
Sequences
cDNA Sequence
- >LOC_Os01g58420.1
ATCCTAGACGCCACACACACCCAAACCCAACCTCCCAAAACACCCACCCGGTTTACCAGAGATCCGCGCCCGCCACTTGTAAACCTGCTGCACCCATGGCGCCCAGAGCAGCTACGGTGGAGAAGGTTGCTGTGGCGCCACCCACCGGGCTTGGTCTTGGCGTCGGCGGAGGTGTCGGAGCCGGGGGTCCTCACTACAGGGGCGTCCGCAAGCGCCCGTGGGGGCGTTACGCAGCGGAGATCCGTGACCCTGCCAAGAAGAGCCGGGTGTGGCTCGGTACCTACGACACGGCAGAGGAGGCCGCCCGCGCCTACGACGCCGCCGCTCGAGAGTTCCGGGGTGCCAAGGCAAAAACAAACTTTCCGTTTGCATCACAGTCGATGGTCGGCTGTGGCGGCAGCCCCAGCAGCAATAGCACGGTAGACACCGGTGGCGGCGGGGTTCAGACGCCTATGCGGGCCATGCCTCTGCCGCCGACTCTGGACTTGGATTTGTTCCACCGCGCGGCTGCTGTGACTGCAGTCGCCGGCACCGGCGTTCGCTTTCCTTTCAGAGGATATCCCGTTGCACGTCCAGCAACGCATCCTTACTTTTTCTATGAGCAGGCTGCAGCGGCTGCCGCAGCTGAGGCTGGATACCGTATGATGAAGCTTGCACCGCCGGTCACCGTGGCGGCGGTTGCACAAAGTGACTCCGACTCCTCGTCGGTGGTTGATCTCGCGCCGTCACCTCCAGCGGTTACGGCGAACAAGGCGGCAGCTTTCGATCTGGATCTGAACCGGCCGCCGCCGGTAGAGAACTAGCTCAGGATGGGTTAGCTGACGACTTTGTAGTTTCTCTCTTATTTTCTTCTTTGATGGATATTTCTCTCCGATGTTTTGGTCCTCTGTGTTTTTGTTTAGTAGCCTGTGAGAGACGGAAGAGCCTTGTAAATAGTTTTTCTGCCGAGGGCGAAATTCATCTTGGGATCTGTTAATTAGAACAGATCATGCCGGCGATGAGATGGACTAAACCGTGGAGTGTATGTATTCCTTTATATTAGTATGAAGAAATTATTCAGAAAGTCACAAAAATATCTGTGCACACTGAGTTTGATTGACGTTTTTA
CDS Sequence
- >LOC_Os01g58420.1
ATGGCGCCCAGAGCAGCTACGGTGGAGAAGGTTGCTGTGGCGCCACCCACCGGGCTTGGTCTTGGCGTCGGCGGAGGTGTCGGAGCCGGGGGTCCTCACTACAGGGGCGTCCGCAAGCGCCCGTGGGGGCGTTACGCAGCGGAGATCCGTGACCCTGCCAAGAAGAGCCGGGTGTGGCTCGGTACCTACGACACGGCAGAGGAGGCCGCCCGCGCCTACGACGCCGCCGCTCGAGAGTTCCGGGGTGCCAAGGCAAAAACAAACTTTCCGTTTGCATCACAGTCGATGGTCGGCTGTGGCGGCAGCCCCAGCAGCAATAGCACGGTAGACACCGGTGGCGGCGGGGTTCAGACGCCTATGCGGGCCATGCCTCTGCCGCCGACTCTGGACTTGGATTTGTTCCACCGCGCGGCTGCTGTGACTGCAGTCGCCGGCACCGGCGTTCGCTTTCCTTTCAGAGGATATCCCGTTGCACGTCCAGCAACGCATCCTTACTTTTTCTATGAGCAGGCTGCAGCGGCTGCCGCAGCTGAGGCTGGATACCGTATGATGAAGCTTGCACCGCCGGTCACCGTGGCGGCGGTTGCACAAAGTGACTCCGACTCCTCGTCGGTGGTTGATCTCGCGCCGTCACCTCCAGCGGTTACGGCGAACAAGGCGGCAGCTTTCGATCTGGATCTGAACCGGCCGCCGCCGGTAGAGAACTAG
Protein Sequence
- >LOC_Os01g58420.1
MAPRAATVEKVAVAPPTGLGLGVGGGVGAGGPHYRGVRKRPWGRYAAEIRDPAKKSRVWLGTYDTAEEAARAYDAAAREFRGAKAKTNFPFASQSMVGCGGSPSSNSTVDTGGGGVQTPMRAMPLPPTLDLDLFHRAAAVTAVAGTGVRFPFRGYPVARPATHPYFFYEQAAAAAAAEAGYRMMKLAPPVTVAAVAQSDSDSSSVVDLAPSPPAVTANKAAAFDLDLNRPPPVEN*