Information report for OsPR1b;PR1b
Gene Details
|
|
Functional Descriptions
- Exogenous ET (ethephon) and JA (methyl jasmonate) supply on the shoots induced a strong systemic defense response in the roots, exemplified by a major up-regulation of pathogenesis-related genes OsPR1a and OsPR1b, while the salicylic acid analog BTH (benzo-1,2,3-thiadiazole-7-carbothioic acid S-methyl ester) was a less potent systemic defense inducer from shoot to root.
- Here, we report characterization of a rice basic PR1 (OsPR1b) gene, identified from screening a cDNA library prepared from jasmonic acid (JA)-treated rice seedling leaf, providing detailed and valuable insights into rice PR1 gene expression.
- Co-treatment of leaf blades with CK and salicylic acid (SA), but not with either one alone, markedly induced pathogenesis-related genes OsPR1b and probenazole-induced protein 1 (PBZ1).
- The simultaneous application of SA, and ABA, with JA, respectively, showed almost complete inhibition of the JA-induced OsPR1b transcript by 200 microM SA or ABA, but not by 100 microM concentrated solutions, suggesting a potential interaction among JA, SA, and ABA, whereas KN dramatically enhanced JA-induced OsPR1b transcript upon simultaneous application.
- The JA-inducible OsPR1b gene was also up-regulated by salicylic acid (SA), abscisic acid (ABA), and kinetin (KN).
- Furthermore, two marker genes in defense signaling pathway, OsNPR1 and OsPR1b, were constitutively expressed in OsWRKY71-overexpressing transgenic plants.
- These results suggest that OsWRKY71 might function as a transcriptional regulator upstream of OsNPR1 and OsPR1b in rice defense signaling pathways.
- We postulated that OsPR1b may participate in the resistance signaling pathway of rice.
- Of simultaneous treatments with hormones and pathogenic bacteria, exogenously applying JA and ET significantly increased the expression level of OsPR1b genes in seedlings.
- However, cotreatment with JA or ET and pathogenic bacteria managed to significantly upregulate the expression level of the OsPR1b gene by 4.
- Compared with the control group that was inoculated with water, inoculation with a mixture of water and pathogenic bacteria hardly affected the expression level of OsPR1b gene, while cotreatment with SA and pathogenic bacteria slightly upregulated the expression level.
- Interestingly, exposure to a rice bacterial pathogen also triggered the expression of OsDXS3 while the expression of Os02g0582900 and PR1b was down-regulated, suggesting that these genes might play a key role in rice-bacteria interactions.
Functional Keywords
- defense-response , jasmonic-acid , leaf , salicylic-acid , shoot , sa , jasmonic , defense , root , ja , jasmonate , seedling , resistance , JA , seedlings , SA , pathogen
Literature and News
- Rice (Oryza sativa L.) OsPR1b gene is phytohormonally regulated in close interaction with light signals . DOI: 10.1006/bbrc.2000.3781 ; PMID: 11097833
- The jasmonate pathway is a key player in systemically induced defense against root knot nematodes in rice . DOI: 10.1104/pp.111.177576 ; PMID: 21715672
- Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180) . DOI: 10.1007/s00438-008-0322-9 ; PMID: 18247056
- OsWRKY71, a rice transcription factor, is involved in rice defense response . DOI: 10.1016/j.jplph.2006.07.006 ; PMID: 16919842
- Functional analysis and expressional characterization of rice ankyrin repeat-containing protein, OsPIANK1, in basal defense against Magnaporthe oryzae attack . DOI: 10.1371/journal.pone.0059699 ; PMID: 23555750
- Cytokinins act synergistically with salicylic acid to activate defense gene expression in rice . DOI: 10.1094/MPMI-06-12-0152-R ; PMID: 23234404
- Screening of rice (Oryza sativa L.) OsPR1b-interacting factors and their roles in resisting bacterial blight . DOI: 10.4238/2015.March.13.15 ; PMID: 25867332
- Magnaporthe oryzae systemic defense trigger 1 (MoSDT1)-mediated metabolites regulate defense response in Rice . DOI: 10.1186/s12870-020-02821-6 ; PMID: 33430779
- Identification of a small set of genes commonly regulated in rice roots in response to beneficial rhizobacteria . DOI: 10.1007/s12298-020-00911-1 ; PMID: 33424163
- Rice iron storage protein ferritin 2 (OsFER2) positively regulates ferroptotic cell death and defense responses against Magnaporthe oryzae . DOI: 10.3389/fpls.2022.1019669 ; PMID: 36352872
Gene Resources
- UniProt: Q7F1Q9
- EMBL: AP003536, AP014957
- EnsemblPlants: Os01t0382000-01
- Gramene: Os01t0382000-01
- KEGG: osa:4325422
- Orthologous matrix: RTTHYYK
- InterPro: IPR001283, IPR002413, IPR014044
- PANTHER: PTHR10334
Homologs
- Gossypium barbadense: Gobar.D13G054300
- Saccharum spontaneum: Sspon.07G0026410-1B, Sspon.07G0026410-1P
- Setaria italica: Seita.1G159400
- Setaria viridis: SEVIR_1G160400v2
Sequences
cDNA Sequence
- >LOC_Os01g28450.1
TTGCAACATCAAAGCTACACAGGTAGAATCATCGACCGTAAGTAAGTACTACTCCTACGTACATTAAGTGTGAGCTTGATTAACTATGGAGGTATCCAAGCTGGCCATTGCTTTGGCCATGGTAGCCGCCATGGCACTCCCCTCCCAAGCTCAAAACTCCCCGCAGGACTACGTGAGGCTCCACAACGCCGCCCGCGCCGCCGTCGGCGTGGGTCCGGTGACCTGGGACACGAGCGTGCAGGCGTTCGCGGAGAACTACGCCAGCCAGAGAAGCGGCGACTGCAGCCTGATCCACTCCAGCAACCGGAACAACCTTGGCGAGAACCTCTTCTGGGGTTCGGCCGGCGGGGACTGGACGGCGGCGAGCGCGGTGCAGTCGTGGGTGGGCGAGAAGAGCGACTACGACTACGCCTCCAACAGCTGCGCGCAGGGGAAGGTGTGCGGGCACTACACGCAGGTGGTGTGGCGCGCGTCGACCAGCATCGGCTGCGCCCGCGTCGTCTGCAGCAACGGCCGCGGCGTCTTCATCACATGCAACTATAAGCCGGCCGGCAACTTCGTCGGACAGAGGCCTTACTAAGTTATTTATACACACGGGCGTACGTACTGGCTAGTACTACGTATAGTAGTGAATAAATAAAGACGTGAAAATGTAAACAGGTCAGTGTCTGATCCACGCCTTCACGGTCCATACCGAGGATTCTATAAAGCGTCATGTCGTACAAGTAAAAATAAATAGTACTCCCTCTGTTTCTTTCTGTTTCAGGTTATAACACCTATTAACTTTGGTTAAAGTTAAATTGCTTTAAATTTAACTAAGTTTGTAGAA
CDS Sequence
- >LOC_Os01g28450.1
ATGGAGGTATCCAAGCTGGCCATTGCTTTGGCCATGGTAGCCGCCATGGCACTCCCCTCCCAAGCTCAAAACTCCCCGCAGGACTACGTGAGGCTCCACAACGCCGCCCGCGCCGCCGTCGGCGTGGGTCCGGTGACCTGGGACACGAGCGTGCAGGCGTTCGCGGAGAACTACGCCAGCCAGAGAAGCGGCGACTGCAGCCTGATCCACTCCAGCAACCGGAACAACCTTGGCGAGAACCTCTTCTGGGGTTCGGCCGGCGGGGACTGGACGGCGGCGAGCGCGGTGCAGTCGTGGGTGGGCGAGAAGAGCGACTACGACTACGCCTCCAACAGCTGCGCGCAGGGGAAGGTGTGCGGGCACTACACGCAGGTGGTGTGGCGCGCGTCGACCAGCATCGGCTGCGCCCGCGTCGTCTGCAGCAACGGCCGCGGCGTCTTCATCACATGCAACTATAAGCCGGCCGGCAACTTCGTCGGACAGAGGCCTTACTAA
Protein Sequence
- >LOC_Os01g28450.1
MEVSKLAIALAMVAAMALPSQAQNSPQDYVRLHNAARAAVGVGPVTWDTSVQAFAENYASQRSGDCSLIHSSNRNNLGENLFWGSAGGDWTAASAVQSWVGEKSDYDYASNSCAQGKVCGHYTQVVWRASTSIGCARVVCSNGRGVFITCNYKPAGNFVGQRPY*