Information report for OsGrx_C7
Gene Details
|
|
Functional Descriptions
- Overexpression of Rice Glutaredoxin OsGrx_C7 and OsGrx_C2.1 Reduces Intracellular Arsenic Accumulation and Increases Tolerance in Arabidopsis thaliana.
- Gene expression analysis suggested that OsGrx_C7 expression was induced under salt stress and ubiquitously expressed in rice including root and shoot.
- A gain-of-function approach showed that OsGrx_C7 may act as an important determinant in salt stress, compared with WT, and revealed higher biomass accumulation, improved root and plant growth under salt stress.
- CC-type glutaredoxin, OsGrx_C7 plays a crucial role in enhancing protection against salt stress in rice.
- Gene expression analysis, silencing, and overexpression of OsGrx_C7 gene were used to discover the role of OsGrx_C7 in response to salt stress.
- The silencing of OsGrx_C7 gene leads to increased sensitivity to salt stress, indicating its importance in salt stress tolerance.
- Under salt stress condition, OsGrx_C7 overexpressing rice plants showed lower level of lipid peroxidation and Na+/K+ ratio, while proline accumulation, soluble sugar content and GSH/GSSG ratio was higher compared to WT.
- Furthermore, expression analysis suggested that OsGrx_C7 acted as positive regulator of salt tolerance by reinforcing the expression of transporters (OsHKT2;1, OsHKT1;5 and OsSOS1) engaged in Na+ homeostasis in overexpressing plants.
- Overall our study revealed that OsGrx_C7 emerged as a key mediator in response to salt stress in rice and could be used for engineering tolerance against salt stress in rice and other crops.
Functional Keywords
- tolerance , arsenic-accumulation , root , growth , shoot , salt , salt-tolerance , salt-stress , stress , homeostasis , plant-growth , biomass , sugar , stress-tolerance
Literature and News
- Overexpression of rice glutaredoxins (OsGrxs) significantly reduces arsenite accumulation by maintaining glutathione pool and modulating aquaporins in yeast . DOI: 10.1016/j.plaphy.2016.04.052 ; PMID: 27174139
- Overexpression of Rice Glutaredoxin OsGrx_C7 and OsGrx_C2.1 Reduces Intracellular Arsenic Accumulation and Increases Tolerance in Arabidopsis thaliana . DOI: 10.3389/fpls.2016.00740 ; PMID: 27313586
- CC-type glutaredoxin, OsGrx_C7 plays a crucial role in enhancing protection against salt stress in rice . DOI: 10.1016/j.jbiotec.2021.02.008 ; PMID: 33610657
Gene Resources
- UniProt: Q7G8Y5
- EMBL: AC011806, AK107858, AP003236
- AlphaFoldDB: Q7G8Y5
- EnsemblPlants: Os01t0368900-01
- Gramene: Os01t0368900-01
- KEGG: dosa:Os01g0368900
- InterPro: IPR002109, IPR011905, IPR036249
- PANTHER: PTHR10168
Homologs
- Arabidopsis thaliana: AT3G21460, AT4G15680, AT4G15700, AT4G15670
- Citrullus lanatus: Cla97C06G111230
- Daucus carota: DCAR_014492
- Glycine max: Glyma.16G052800
- Juglans regia: Jr10_00590
- Lactuca sativa: gene-LSAT_3X32020, gene-LSAT_0X3441
- Manihot esculenta: MANES_13G007200
- Medicago truncatula: Medtr7g026770
- Populus trichocarpa: POPTR_001G325800v3
- Prunus avium: Pav_sc0001080.1_g710.1.mk
- Prunus persica: PRUPE_3G309600
- Rosa chinensis: RchiOBHm_Chr2g0176061
- Vitis vinifera: VIT_01s0146g00220
Sequences
cDNA Sequence
- >LOC_Os01g27140.1
GCACAGCTCAAAGCAAAGCAAAGCACAACACAATCAAAGCCTCATACAAGAAGCTAGCTAGCTAGTACTCAAGCTAAATACCTAGCTAGCAGTAGCAGGCGACCAGCTGCATTTTTCCAGAGGAAAAATCTCTCAGTTTAGCTTAATTAATTAGCTCTTGGGAGAAGAAGGCAAGAAGAAAATGGACAGGGTGAACAGGCTGGCGGCGCAGCGGGCGGTGGTGATCTTCAGCATGAGCTCGTGCTGCATGTGCCACACCGTGACGCGCCTCTTCTGCGAGCTCGGGGTGAACCCGACGGTGGTGGAGCTGGACGAGGACCCGAGGGGGAAGGAGATGGAGAAGGCGCTGGCGAGGCTCCTCGGCCGCAGCCCCGCCGTGCCGGCGGTGTTCATCGGCGGGAGGCTCGTCGGCTCCACCGACAAGGTCATGTCGCTGCACCTCAGCGGCAACCTTGTCCCGCTGCTTCGCAATGCGGGTGCCCTCTGGGTGTAGCACCAACGACGCAACTATACCTACCAGCGACTGGTTCTTGATTTGGACTGATACCGTGGCGCAGAATAATTTTATACGGGTACTTTGGTTTGTATCAGGCAGGTCAGGTATATCTAAGGGAAAATAAATAGTACGTGCAGGCCTTTTTTGCACTGCAATACTAGTAAATCTATAGAGAGTGGGGAATTAAGTGTGTCATGTCAGCCGCCTGTAAGGCTCTTTTGAGATGTAATAATGACACATATCCGTTTAATGGAGTATACCTCTTTTGTCGA
CDS Sequence
- >LOC_Os01g27140.1
ATGGACAGGGTGAACAGGCTGGCGGCGCAGCGGGCGGTGGTGATCTTCAGCATGAGCTCGTGCTGCATGTGCCACACCGTGACGCGCCTCTTCTGCGAGCTCGGGGTGAACCCGACGGTGGTGGAGCTGGACGAGGACCCGAGGGGGAAGGAGATGGAGAAGGCGCTGGCGAGGCTCCTCGGCCGCAGCCCCGCCGTGCCGGCGGTGTTCATCGGCGGGAGGCTCGTCGGCTCCACCGACAAGGTCATGTCGCTGCACCTCAGCGGCAACCTTGTCCCGCTGCTTCGCAATGCGGGTGCCCTCTGGGTGTAG
Protein Sequence
- >LOC_Os01g27140.1
MDRVNRLAAQRAVVIFSMSSCCMCHTVTRLFCELGVNPTVVELDEDPRGKEMEKALARLLGRSPAVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLRNAGALWV*